Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 68428..68954 | Replicon | plasmid unnamed1 |
Accession | NZ_CP115690 | ||
Organism | Enterobacter hormaechei strain 2020CK-00204 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | PF325_RS24335 | Protein ID | WP_000323025.1 |
Coordinates | 68428..68715 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | PF325_RS24340 | Protein ID | WP_000534858.1 |
Coordinates | 68715..68954 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PF325_RS24295 (PF325_24295) | 63549..64016 | - | 468 | WP_127312814.1 | hypothetical protein | - |
PF325_RS24300 (PF325_24300) | 64009..64431 | - | 423 | WP_045620781.1 | MgtC/SapB family protein | - |
PF325_RS24305 (PF325_24305) | 64428..64721 | - | 294 | WP_047723347.1 | hypothetical protein | - |
PF325_RS24310 (PF325_24310) | 64735..66138 | - | 1404 | WP_045620748.1 | F-type conjugal transfer pilus assembly protein TraB | - |
PF325_RS24315 (PF325_24315) | 66141..66800 | - | 660 | WP_271040833.1 | F-type conjugal transfer protein TraK | - |
PF325_RS24320 (PF325_24320) | 66739..66897 | - | 159 | WP_223861909.1 | hypothetical protein | - |
PF325_RS24325 (PF325_24325) | 67007..67321 | - | 315 | WP_045620735.1 | hypothetical protein | - |
PF325_RS24330 (PF325_24330) | 68202..68375 | - | 174 | WP_230676869.1 | DUF5431 family protein | - |
PF325_RS24335 (PF325_24335) | 68428..68715 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
PF325_RS24340 (PF325_24340) | 68715..68954 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
PF325_RS24345 (PF325_24345) | 68979..69083 | + | 105 | Protein_69 | protein YdfV | - |
PF325_RS24350 (PF325_24350) | 69217..70140 | - | 924 | WP_000167917.1 | cation diffusion facilitator family transporter | - |
PF325_RS24355 (PF325_24355) | 70340..70543 | - | 204 | Protein_71 | cytochrome b/b6 domain-containing protein | - |
PF325_RS24360 (PF325_24360) | 70612..71592 | + | 981 | WP_057058223.1 | IS5-like element IS5 family transposase | - |
PF325_RS24365 (PF325_24365) | 71982..73016 | + | 1035 | Protein_73 | IS481 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..136056 | 136056 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T267277 WP_000323025.1 NZ_CP115690:c68715-68428 [Enterobacter hormaechei]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|