Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 4851896..4852512 | Replicon | chromosome |
| Accession | NZ_CP115689 | ||
| Organism | Enterobacter hormaechei strain 2020CK-00204 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PF325_RS23610 | Protein ID | WP_015569913.1 |
| Coordinates | 4851896..4852267 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A6G4MTK3 |
| Locus tag | PF325_RS23615 | Protein ID | WP_015569912.1 |
| Coordinates | 4852270..4852512 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PF325_RS23595 (PF325_23595) | 4849396..4850298 | + | 903 | WP_014072386.1 | formate dehydrogenase subunit beta | - |
| PF325_RS23600 (PF325_23600) | 4850295..4850930 | + | 636 | WP_252051972.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PF325_RS23605 (PF325_23605) | 4850927..4851856 | + | 930 | WP_003861956.1 | formate dehydrogenase accessory protein FdhE | - |
| PF325_RS23610 (PF325_23610) | 4851896..4852267 | - | 372 | WP_015569913.1 | PIN domain-containing protein | Toxin |
| PF325_RS23615 (PF325_23615) | 4852270..4852512 | - | 243 | WP_015569912.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| PF325_RS23620 (PF325_23620) | 4852711..4853631 | + | 921 | WP_015569911.1 | alpha/beta hydrolase | - |
| PF325_RS23625 (PF325_23625) | 4853640..4854581 | - | 942 | WP_015569910.1 | fatty acid biosynthesis protein FabY | - |
| PF325_RS23630 (PF325_23630) | 4854626..4855063 | - | 438 | WP_015569909.1 | D-aminoacyl-tRNA deacylase | - |
| PF325_RS23635 (PF325_23635) | 4855060..4855941 | - | 882 | WP_003861949.1 | virulence factor BrkB family protein | - |
| PF325_RS23640 (PF325_23640) | 4855935..4856534 | - | 600 | WP_017694048.1 | glucose-1-phosphatase | - |
| PF325_RS23645 (PF325_23645) | 4856653..4857453 | - | 801 | WP_003861944.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13767.90 Da Isoelectric Point: 6.4882
>T267276 WP_015569913.1 NZ_CP115689:c4852267-4851896 [Enterobacter hormaechei]
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVSARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVSARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|