Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 4723259..4723863 | Replicon | chromosome |
Accession | NZ_CP115689 | ||
Organism | Enterobacter hormaechei strain 2020CK-00204 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A2J0PXG2 |
Locus tag | PF325_RS23040 | Protein ID | WP_071788668.1 |
Coordinates | 4723678..4723863 (-) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A2G4ZRB5 |
Locus tag | PF325_RS23035 | Protein ID | WP_023295606.1 |
Coordinates | 4723259..4723663 (-) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PF325_RS23020 (PF325_23020) | 4718799..4719617 | - | 819 | WP_032649828.1 | helix-turn-helix domain-containing protein | - |
PF325_RS23025 (PF325_23025) | 4719843..4721243 | + | 1401 | WP_017693791.1 | MFS transporter | - |
PF325_RS23030 (PF325_23030) | 4721254..4723203 | + | 1950 | WP_271040488.1 | glycoside hydrolase family 127 protein | - |
PF325_RS23035 (PF325_23035) | 4723259..4723663 | - | 405 | WP_023295606.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PF325_RS23040 (PF325_23040) | 4723678..4723863 | - | 186 | WP_071788668.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PF325_RS23045 (PF325_23045) | 4724113..4725651 | - | 1539 | WP_006808612.1 | aldehyde dehydrogenase AldB | - |
PF325_RS23050 (PF325_23050) | 4725818..4726702 | + | 885 | WP_015572761.1 | ROK family protein | - |
PF325_RS23055 (PF325_23055) | 4726706..4728544 | - | 1839 | WP_023295607.1 | selenocysteine-specific translation elongation factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6822.05 Da Isoelectric Point: 11.5191
>T267275 WP_071788668.1 NZ_CP115689:c4723863-4723678 [Enterobacter hormaechei]
VKSADIIAVLVSHGWKCVRTKGSHHQFRHPVQKGLVTVPHPKKDIKPGTLAQIWRQAGIKH
VKSADIIAVLVSHGWKCVRTKGSHHQFRHPVQKGLVTVPHPKKDIKPGTLAQIWRQAGIKH
Download Length: 186 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14954.71 Da Isoelectric Point: 4.2329
>AT267275 WP_023295606.1 NZ_CP115689:c4723663-4723259 [Enterobacter hormaechei]
MFYPAYIHSDSDGSASGFFPDVPGCFFAGDSLDDAFQDARDALTAHFEALFEMDEALPLPGSVEVHLENQPDDFTGGQWL
LVDINMKQFDGRAERINITMPRRLLVKIDSFVSEHPQFGNRSAFLAEAARRVLP
MFYPAYIHSDSDGSASGFFPDVPGCFFAGDSLDDAFQDARDALTAHFEALFEMDEALPLPGSVEVHLENQPDDFTGGQWL
LVDINMKQFDGRAERINITMPRRLLVKIDSFVSEHPQFGNRSAFLAEAARRVLP
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J0PXG2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2G4ZRB5 |