Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4042743..4043400 | Replicon | chromosome |
| Accession | NZ_CP115689 | ||
| Organism | Enterobacter hormaechei strain 2020CK-00204 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A179PSF7 |
| Locus tag | PF325_RS19740 | Protein ID | WP_017382887.1 |
| Coordinates | 4042743..4043153 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | G8LDB7 |
| Locus tag | PF325_RS19745 | Protein ID | WP_003863437.1 |
| Coordinates | 4043134..4043400 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PF325_RS19720 (PF325_19720) | 4038741..4040474 | - | 1734 | WP_032649421.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| PF325_RS19725 (PF325_19725) | 4040480..4041193 | - | 714 | WP_003863443.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PF325_RS19730 (PF325_19730) | 4041222..4042118 | - | 897 | WP_003863442.1 | site-specific tyrosine recombinase XerD | - |
| PF325_RS19735 (PF325_19735) | 4042220..4042741 | + | 522 | WP_015571793.1 | flavodoxin FldB | - |
| PF325_RS19740 (PF325_19740) | 4042743..4043153 | - | 411 | WP_017382887.1 | protein YgfX | Toxin |
| PF325_RS19745 (PF325_19745) | 4043134..4043400 | - | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
| PF325_RS19750 (PF325_19750) | 4043695..4044675 | + | 981 | WP_022649306.1 | tRNA-modifying protein YgfZ | - |
| PF325_RS19755 (PF325_19755) | 4044787..4045446 | - | 660 | WP_047050804.1 | hemolysin III family protein | - |
| PF325_RS19760 (PF325_19760) | 4045713..4046444 | + | 732 | WP_047050802.1 | MurR/RpiR family transcriptional regulator | - |
| PF325_RS19765 (PF325_19765) | 4046561..4047994 | + | 1434 | WP_032660252.1 | 6-phospho-beta-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16321.21 Da Isoelectric Point: 11.4775
>T267274 WP_017382887.1 NZ_CP115689:c4043153-4042743 [Enterobacter hormaechei]
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A179PSF7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837F8P5 |