Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 2485744..2486483 | Replicon | chromosome |
| Accession | NZ_CP115689 | ||
| Organism | Enterobacter hormaechei strain 2020CK-00204 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | PF325_RS12295 | Protein ID | WP_045329830.1 |
| Coordinates | 2485744..2486229 (-) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A837FCR9 |
| Locus tag | PF325_RS12300 | Protein ID | WP_003857131.1 |
| Coordinates | 2486217..2486483 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PF325_RS12270 (PF325_12270) | 2481127..2481885 | + | 759 | WP_015570520.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PF325_RS12275 (PF325_12275) | 2481990..2483282 | + | 1293 | WP_271040259.1 | glycosyl hydrolase family 28 protein | - |
| PF325_RS12280 (PF325_12280) | 2483282..2483896 | + | 615 | WP_080338042.1 | NUDIX hydrolase | - |
| PF325_RS12285 (PF325_12285) | 2484143..2485108 | + | 966 | WP_214587177.1 | hypothetical protein | - |
| PF325_RS12290 (PF325_12290) | 2485124..2485693 | + | 570 | WP_063847895.1 | hypothetical protein | - |
| PF325_RS12295 (PF325_12295) | 2485744..2486229 | - | 486 | WP_045329830.1 | GNAT family N-acetyltransferase | Toxin |
| PF325_RS12300 (PF325_12300) | 2486217..2486483 | - | 267 | WP_003857131.1 | DUF1778 domain-containing protein | Antitoxin |
| PF325_RS12305 (PF325_12305) | 2486547..2487476 | - | 930 | WP_047726560.1 | LysR family transcriptional regulator | - |
| PF325_RS12310 (PF325_12310) | 2487606..2488994 | + | 1389 | WP_252051113.1 | MFS transporter | - |
| PF325_RS12315 (PF325_12315) | 2489017..2490012 | - | 996 | WP_017382342.1 | DUF2891 domain-containing protein | - |
| PF325_RS12320 (PF325_12320) | 2490022..2491008 | - | 987 | WP_017382341.1 | DUF979 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17512.18 Da Isoelectric Point: 9.9658
>T267269 WP_045329830.1 NZ_CP115689:c2486229-2485744 [Enterobacter hormaechei]
VGRVTAPEPLSSAHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
VGRVTAPEPLSSAHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|