Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
| Location | 971649..972328 | Replicon | chromosome |
| Accession | NZ_CP115689 | ||
| Organism | Enterobacter hormaechei strain 2020CK-00204 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | S1FHS4 |
| Locus tag | PF325_RS04575 | Protein ID | WP_000854680.1 |
| Coordinates | 971649..971990 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yafW | Uniprot ID | A0A5C1BXL1 |
| Locus tag | PF325_RS04580 | Protein ID | WP_023336793.1 |
| Coordinates | 972011..972328 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PF325_RS04550 (PF325_04550) | 966821..967222 | + | 402 | WP_006809999.1 | sigma factor-binding protein Crl | - |
| PF325_RS04555 (PF325_04555) | 967354..968406 | - | 1053 | WP_252051384.1 | phosphoporin PhoE | - |
| PF325_RS04560 (PF325_04560) | 968712..969815 | + | 1104 | WP_252051381.1 | glutamate 5-kinase | - |
| PF325_RS04565 (PF325_04565) | 969827..971080 | + | 1254 | WP_058689030.1 | glutamate-5-semialdehyde dehydrogenase | - |
| PF325_RS04575 (PF325_04575) | 971649..971990 | - | 342 | WP_000854680.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
| PF325_RS04580 (PF325_04580) | 972011..972328 | - | 318 | WP_023336793.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
| PF325_RS04585 (PF325_04585) | 972347..972568 | - | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
| PF325_RS04590 (PF325_04590) | 972577..973053 | - | 477 | WP_023336794.1 | RadC family protein | - |
| PF325_RS04595 (PF325_04595) | 973069..973527 | - | 459 | WP_000211838.1 | antirestriction protein | - |
| PF325_RS04600 (PF325_04600) | 973625..973864 | - | 240 | WP_000194654.1 | DUF905 family protein | - |
| PF325_RS04605 (PF325_04605) | 973941..974408 | - | 468 | WP_001581459.1 | protein YkfB | - |
| PF325_RS04610 (PF325_04610) | 974432..974875 | - | 444 | WP_000824223.1 | lipoprotein YafY | - |
| PF325_RS04615 (PF325_04615) | 974875..975111 | - | 237 | WP_001144031.1 | protein YpjK | - |
| PF325_RS04620 (PF325_04620) | 975152..975853 | - | 702 | WP_006812588.1 | WYL domain-containing protein | - |
| PF325_RS04625 (PF325_04625) | 976070..976891 | - | 822 | WP_000197389.1 | DUF932 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12892.95 Da Isoelectric Point: 9.6543
>T267266 WP_000854680.1 NZ_CP115689:c971990-971649 [Enterobacter hormaechei]
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1FHS4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5C1BXL1 |