Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 635369..635945 | Replicon | chromosome |
| Accession | NZ_CP115689 | ||
| Organism | Enterobacter hormaechei strain 2020CK-00204 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | A0A800YKM1 |
| Locus tag | PF325_RS03020 | Protein ID | WP_015572580.1 |
| Coordinates | 635369..635656 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A801DSF4 |
| Locus tag | PF325_RS03025 | Protein ID | WP_017694570.1 |
| Coordinates | 635643..635945 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PF325_RS02995 (PF325_02995) | 630462..631181 | + | 720 | WP_108394133.1 | winged helix-turn-helix domain-containing protein | - |
| PF325_RS03000 (PF325_03000) | 631331..631801 | + | 471 | WP_015572576.1 | MarR family transcriptional regulator | - |
| PF325_RS03005 (PF325_03005) | 631798..632865 | + | 1068 | WP_026080654.1 | HlyD family secretion protein | - |
| PF325_RS03010 (PF325_03010) | 632855..633931 | + | 1077 | WP_015572578.1 | DUF2955 domain-containing protein | - |
| PF325_RS03015 (PF325_03015) | 633928..635199 | - | 1272 | WP_252051980.1 | DUF445 domain-containing protein | - |
| PF325_RS03020 (PF325_03020) | 635369..635656 | + | 288 | WP_015572580.1 | BrnT family toxin | Toxin |
| PF325_RS03025 (PF325_03025) | 635643..635945 | + | 303 | WP_017694570.1 | BrnA antitoxin family protein | Antitoxin |
| PF325_RS03030 (PF325_03030) | 635974..636612 | - | 639 | WP_017694569.1 | LysE family translocator | - |
| PF325_RS03035 (PF325_03035) | 636651..637403 | - | 753 | WP_015572582.1 | AraC family transcriptional regulator | - |
| PF325_RS03040 (PF325_03040) | 637557..638927 | + | 1371 | WP_017694568.1 | NAD-dependent succinate-semialdehyde dehydrogenase | - |
| PF325_RS03045 (PF325_03045) | 639105..639650 | - | 546 | WP_006810254.1 | YfaZ family outer membrane protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11296.81 Da Isoelectric Point: 7.3587
>T267265 WP_015572580.1 NZ_CP115689:635369-635656 [Enterobacter hormaechei]
MPIEYEWDSNKAKSNLQKHAIRFEDAVLVFDDPCHLSVQDRYENGEFRWQTIGLVQGVIVILVAHTVRFESGDEIIRIIS
ARKADRKERRRYEHR
MPIEYEWDSNKAKSNLQKHAIRFEDAVLVFDDPCHLSVQDRYENGEFRWQTIGLVQGVIVILVAHTVRFESGDEIIRIIS
ARKADRKERRRYEHR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|