Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 315923..316519 | Replicon | chromosome |
Accession | NZ_CP115689 | ||
Organism | Enterobacter hormaechei strain 2020CK-00204 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | PF325_RS01515 | Protein ID | WP_023295756.1 |
Coordinates | 316217..316519 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A927HL08 |
Locus tag | PF325_RS01510 | Protein ID | WP_023295755.1 |
Coordinates | 315923..316210 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PF325_RS01505 (PF325_01505) | 314295..315926 | + | 1632 | WP_003860350.1 | Na/Pi cotransporter family protein | - |
PF325_RS01510 (PF325_01510) | 315923..316210 | - | 288 | WP_023295755.1 | putative addiction module antidote protein | Antitoxin |
PF325_RS01515 (PF325_01515) | 316217..316519 | - | 303 | WP_023295756.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PF325_RS01520 (PF325_01520) | 316717..317589 | + | 873 | WP_003860347.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
PF325_RS01525 (PF325_01525) | 317590..317862 | - | 273 | WP_017382612.1 | DUF3811 domain-containing protein | - |
PF325_RS01530 (PF325_01530) | 317913..318857 | - | 945 | WP_015570166.1 | ketopantoate/pantoate/pantothenate transporter PanS | - |
PF325_RS01535 (PF325_01535) | 318951..320300 | - | 1350 | WP_040117084.1 | lysine-sensitive aspartokinase 3 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11441.24 Da Isoelectric Point: 10.1042
>T267264 WP_023295756.1 NZ_CP115689:c316519-316217 [Enterobacter hormaechei]
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDIRPVGEGISELRIHFGPGYRIYFKDQGNCIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDIRPVGEGISELRIHFGPGYRIYFKDQGNCIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|