Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | kacAT/FR47-DUF1778 |
| Location | 39475..40272 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP115674 | ||
| Organism | Enterobacter hormaechei strain 2020CK-00203 | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | F5S3R9 |
| Locus tag | PF324_RS23635 | Protein ID | WP_006812498.1 |
| Coordinates | 39748..40272 (+) | Length | 175 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | F5S3R8 |
| Locus tag | PF324_RS23630 | Protein ID | WP_006812497.1 |
| Coordinates | 39475..39744 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PF324_RS23605 (PF324_23605) | 34848..36188 | - | 1341 | WP_006812582.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| PF324_RS23610 (PF324_23610) | 36249..36974 | - | 726 | WP_006812583.1 | hypothetical protein | - |
| PF324_RS23615 (PF324_23615) | 37238..38035 | + | 798 | WP_006812584.1 | DUF2971 domain-containing protein | - |
| PF324_RS23620 (PF324_23620) | 38077..38430 | - | 354 | WP_160859104.1 | hypothetical protein | - |
| PF324_RS23625 (PF324_23625) | 38436..39101 | - | 666 | WP_023315962.1 | AAA family ATPase | - |
| PF324_RS23630 (PF324_23630) | 39475..39744 | + | 270 | WP_006812497.1 | DUF1778 domain-containing protein | Antitoxin |
| PF324_RS23635 (PF324_23635) | 39748..40272 | + | 525 | WP_006812498.1 | GNAT family N-acetyltransferase | Toxin |
| PF324_RS23640 (PF324_23640) | 40299..40463 | - | 165 | WP_006812499.1 | hypothetical protein | - |
| PF324_RS23645 (PF324_23645) | 40456..40707 | - | 252 | WP_000147960.1 | hypothetical protein | - |
| PF324_RS23650 (PF324_23650) | 40709..41401 | - | 693 | WP_006812500.1 | membrane protein | - |
| PF324_RS23655 (PF324_23655) | 41415..41738 | - | 324 | WP_000064173.1 | hypothetical protein | - |
| PF324_RS23660 (PF324_23660) | 41813..42601 | - | 789 | WP_032655902.1 | receptor-recognizing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..111387 | 111387 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 175 a.a. Molecular weight: 19356.13 Da Isoelectric Point: 8.9844
>T267263 WP_006812498.1 NZ_CP115674:39748-40272 [Enterobacter hormaechei]
VANLTIEMFSEEAVYDFSCFDCGETSLNDFLNNRLAQQHSGRILRGYLLLTRDPIPKVMGFYTLSGSCFARNTLPSNTQQ
RKVPYSDAPSVTLGRLAIDKSIQRQGYGETLVAHAMKVVYRASLAVGIYALFVDAKNENAMRFYKQLGFTPLTGDNANSL
FYPTKGIEKLFGGK
VANLTIEMFSEEAVYDFSCFDCGETSLNDFLNNRLAQQHSGRILRGYLLLTRDPIPKVMGFYTLSGSCFARNTLPSNTQQ
RKVPYSDAPSVTLGRLAIDKSIQRQGYGETLVAHAMKVVYRASLAVGIYALFVDAKNENAMRFYKQLGFTPLTGDNANSL
FYPTKGIEKLFGGK
Download Length: 525 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J0QWY8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J0QUA3 |