Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 26543..27186 Replicon plasmid unnamed1
Accession NZ_CP115673
Organism Enterobacter hormaechei strain 2020CK-00203

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag PF324_RS22745 Protein ID WP_058672500.1
Coordinates 26543..26959 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID -
Locus tag PF324_RS22750 Protein ID WP_058672491.1
Coordinates 26956..27186 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PF324_RS22720 (22026) 22026..22364 - 339 WP_007374386.1 carboxymuconolactone decarboxylase family protein -
PF324_RS22725 (22381) 22381..22950 - 570 WP_045334638.1 TetR/AcrR family transcriptional regulator -
PF324_RS22730 (23134) 23134..23691 - 558 WP_007374384.1 OsmC family protein -
PF324_RS22735 (23900) 23900..24922 - 1023 WP_045334637.1 helicase UvrD -
PF324_RS22740 (24907) 24907..26469 - 1563 WP_045334636.1 AAA family ATPase -
PF324_RS22745 (26543) 26543..26959 - 417 WP_058672500.1 type II toxin-antitoxin system VapC family toxin Toxin
PF324_RS22750 (26956) 26956..27186 - 231 WP_058672491.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PF324_RS22755 (27573) 27573..27926 + 354 WP_269147465.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
PF324_RS22760 (27976) 27976..28338 + 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
PF324_RS22765 (28356) 28356..30107 + 1752 WP_045334630.1 arsenite efflux transporter ATPase subunit ArsA -
PF324_RS22770 (30155) 30155..31444 + 1290 WP_004152098.1 arsenite efflux transporter membrane subunit ArsB -
PF324_RS22775 (31457) 31457..31882 + 426 WP_045334628.1 glutaredoxin-dependent arsenate reductase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..146783 146783


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-50)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15161.57 Da        Isoelectric Point: 7.2452

>T267262 WP_058672500.1 NZ_CP115673:c26959-26543 [Enterobacter hormaechei]
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRD
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8650.75 Da        Isoelectric Point: 4.5881

>AT267262 WP_058672491.1 NZ_CP115673:c27186-26956 [Enterobacter hormaechei]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQLEKADPDFMAERGDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References