Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 4658227..4658843 | Replicon | chromosome |
| Accession | NZ_CP115672 | ||
| Organism | Enterobacter hormaechei strain 2020CK-00203 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PF324_RS22205 | Protein ID | WP_015569913.1 |
| Coordinates | 4658227..4658598 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A6G4MTK3 |
| Locus tag | PF324_RS22210 | Protein ID | WP_015569912.1 |
| Coordinates | 4658601..4658843 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PF324_RS22190 (PF324_22190) | 4655727..4656629 | + | 903 | WP_014072386.1 | formate dehydrogenase subunit beta | - |
| PF324_RS22195 (PF324_22195) | 4656626..4657261 | + | 636 | WP_015569914.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PF324_RS22200 (PF324_22200) | 4657258..4658187 | + | 930 | WP_003861956.1 | formate dehydrogenase accessory protein FdhE | - |
| PF324_RS22205 (PF324_22205) | 4658227..4658598 | - | 372 | WP_015569913.1 | PIN domain-containing protein | Toxin |
| PF324_RS22210 (PF324_22210) | 4658601..4658843 | - | 243 | WP_015569912.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| PF324_RS22215 (PF324_22215) | 4659042..4659962 | + | 921 | WP_015569911.1 | alpha/beta hydrolase | - |
| PF324_RS22220 (PF324_22220) | 4659971..4660912 | - | 942 | WP_015569910.1 | fatty acid biosynthesis protein FabY | - |
| PF324_RS22225 (PF324_22225) | 4660957..4661394 | - | 438 | WP_015569909.1 | D-aminoacyl-tRNA deacylase | - |
| PF324_RS22230 (PF324_22230) | 4661391..4662272 | - | 882 | WP_003861949.1 | virulence factor BrkB family protein | - |
| PF324_RS22235 (PF324_22235) | 4662266..4662865 | - | 600 | WP_017694048.1 | glucose-1-phosphatase | - |
| PF324_RS22240 (PF324_22240) | 4662984..4663784 | - | 801 | WP_003861944.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13767.90 Da Isoelectric Point: 6.4882
>T267261 WP_015569913.1 NZ_CP115672:c4658598-4658227 [Enterobacter hormaechei]
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVSARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVSARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|