Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2307841..2308580 | Replicon | chromosome |
Accession | NZ_CP115672 | ||
Organism | Enterobacter hormaechei strain 2020CK-00203 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A3L9PBP9 |
Locus tag | PF324_RS11030 | Protein ID | WP_003857133.1 |
Coordinates | 2307841..2308326 (-) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A837FCR9 |
Locus tag | PF324_RS11035 | Protein ID | WP_003857131.1 |
Coordinates | 2308314..2308580 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PF324_RS11005 (PF324_11005) | 2303385..2304143 | - | 759 | WP_017693420.1 | trans-aconitate 2-methyltransferase | - |
PF324_RS11010 (PF324_11010) | 2304228..2304812 | - | 585 | WP_039270753.1 | NUDIX domain-containing protein | - |
PF324_RS11015 (PF324_11015) | 2304899..2305657 | + | 759 | WP_015570520.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
PF324_RS11020 (PF324_11020) | 2305762..2307054 | + | 1293 | WP_032648327.1 | glycosyl hydrolase family 28 protein | - |
PF324_RS11025 (PF324_11025) | 2307054..2307668 | + | 615 | WP_080338042.1 | NUDIX hydrolase | - |
PF324_RS11030 (PF324_11030) | 2307841..2308326 | - | 486 | WP_003857133.1 | GNAT family N-acetyltransferase | Toxin |
PF324_RS11035 (PF324_11035) | 2308314..2308580 | - | 267 | WP_003857131.1 | DUF1778 domain-containing protein | Antitoxin |
PF324_RS11040 (PF324_11040) | 2308644..2309573 | - | 930 | WP_039270752.1 | LysR family transcriptional regulator | - |
PF324_RS11045 (PF324_11045) | 2309703..2311085 | + | 1383 | WP_039270751.1 | MFS transporter | - |
PF324_RS11050 (PF324_11050) | 2311107..2312102 | - | 996 | WP_271039689.1 | DUF2891 domain-containing protein | - |
PF324_RS11055 (PF324_11055) | 2312112..2313098 | - | 987 | WP_023296632.1 | DUF979 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2294477..2308580 | 14103 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17540.23 Da Isoelectric Point: 9.9658
>T267254 WP_003857133.1 NZ_CP115672:c2308326-2307841 [Enterobacter hormaechei]
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3L9PBP9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837FCR9 |