Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1102665..1103285 | Replicon | chromosome |
| Accession | NZ_CP115672 | ||
| Organism | Enterobacter hormaechei strain 2020CK-00203 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A837FFM2 |
| Locus tag | PF324_RS05175 | Protein ID | WP_015571250.1 |
| Coordinates | 1102665..1102883 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | F5RUW7 |
| Locus tag | PF324_RS05180 | Protein ID | WP_006809850.1 |
| Coordinates | 1102911..1103285 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PF324_RS05145 (PF324_05145) | 1098677..1098937 | + | 261 | WP_015571255.1 | type B 50S ribosomal protein L31 | - |
| PF324_RS05150 (PF324_05150) | 1098940..1099080 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| PF324_RS05155 (PF324_05155) | 1099077..1099787 | - | 711 | WP_032670463.1 | GNAT family protein | - |
| PF324_RS05160 (PF324_05160) | 1099889..1101349 | + | 1461 | WP_039271537.1 | PLP-dependent aminotransferase family protein | - |
| PF324_RS05165 (PF324_05165) | 1101321..1101788 | - | 468 | WP_023296041.1 | YlaC family protein | - |
| PF324_RS05170 (PF324_05170) | 1101905..1102456 | - | 552 | WP_015571251.1 | maltose O-acetyltransferase | - |
| PF324_RS05175 (PF324_05175) | 1102665..1102883 | - | 219 | WP_015571250.1 | HHA domain-containing protein | Toxin |
| PF324_RS05180 (PF324_05180) | 1102911..1103285 | - | 375 | WP_006809850.1 | Hha toxicity modulator TomB | Antitoxin |
| PF324_RS05185 (PF324_05185) | 1103796..1106942 | - | 3147 | WP_015571248.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| PF324_RS05190 (PF324_05190) | 1106965..1108158 | - | 1194 | WP_017694395.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8583.95 Da Isoelectric Point: 8.9008
>T267253 WP_015571250.1 NZ_CP115672:c1102883-1102665 [Enterobacter hormaechei]
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14497.28 Da Isoelectric Point: 4.8989
>AT267253 WP_006809850.1 NZ_CP115672:c1103285-1102911 [Enterobacter hormaechei]
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FFM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FGN8 |