Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE(toxin) |
Location | 4940282..4940831 | Replicon | chromosome |
Accession | NZ_CP115669 | ||
Organism | Pseudomonas sp. PSE14 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | O6P39_RS22680 | Protein ID | WP_275608654.1 |
Coordinates | 4940282..4940593 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | O6P39_RS22685 | Protein ID | WP_275608655.1 |
Coordinates | 4940583..4940831 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6P39_RS22650 (O6P39_22650) | 4935597..4935815 | - | 219 | WP_275608649.1 | hypothetical protein | - |
O6P39_RS22655 (O6P39_22655) | 4935808..4936080 | - | 273 | WP_045217776.1 | hypothetical protein | - |
O6P39_RS22660 (O6P39_22660) | 4936723..4937055 | + | 333 | WP_275608650.1 | hypothetical protein | - |
O6P39_RS22665 (O6P39_22665) | 4937099..4937968 | - | 870 | WP_275608651.1 | SIR2 family protein | - |
O6P39_RS22670 (O6P39_22670) | 4937965..4938960 | - | 996 | WP_275608652.1 | ParA family protein | - |
O6P39_RS22675 (O6P39_22675) | 4939105..4939962 | - | 858 | WP_275608653.1 | restriction endonuclease | - |
O6P39_RS22680 (O6P39_22680) | 4940282..4940593 | - | 312 | WP_275608654.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
O6P39_RS22685 (O6P39_22685) | 4940583..4940831 | - | 249 | WP_275608655.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
O6P39_RS22690 (O6P39_22690) | 4941011..4941133 | - | 123 | WP_275608656.1 | hypothetical protein | - |
O6P39_RS22695 (O6P39_22695) | 4941407..4941763 | - | 357 | WP_275612012.1 | SOS response-associated peptidase family protein | - |
O6P39_RS22700 (O6P39_22700) | 4942147..4943145 | - | 999 | WP_275608657.1 | isocitrate/isopropylmalate dehydrogenase family protein | - |
O6P39_RS22705 (O6P39_22705) | 4943223..4943867 | - | 645 | WP_275608658.1 | carbonate dehydratase | - |
O6P39_RS22710 (O6P39_22710) | 4943931..4945175 | - | 1245 | WP_275608659.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11889.86 Da Isoelectric Point: 10.4632
>T267248 WP_275608654.1 NZ_CP115669:c4940593-4940282 [Pseudomonas sp. PSE14]
MNSEPANGPSQYKLRIKDSAEREWRKLPEPIRAAFKKKLAERLANPRVEKDKLTGMKDCYKIKLKDVGYRLVYRVDDGEL
IIEVIAAGKRERGEAYAAARKRL
MNSEPANGPSQYKLRIKDSAEREWRKLPEPIRAAFKKKLAERLANPRVEKDKLTGMKDCYKIKLKDVGYRLVYRVDDGEL
IIEVIAAGKRERGEAYAAARKRL
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|