Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
| Location | 4860346..4860893 | Replicon | chromosome |
| Accession | NZ_CP115669 | ||
| Organism | Pseudomonas sp. PSE14 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | O6P39_RS22265 | Protein ID | WP_275608583.1 |
| Coordinates | 4860606..4860893 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | O6P39_RS22260 | Protein ID | WP_275608582.1 |
| Coordinates | 4860346..4860615 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O6P39_RS22235 (O6P39_22235) | 4855413..4856531 | - | 1119 | WP_275608577.1 | sensor domain-containing diguanylate cyclase | - |
| O6P39_RS22240 (O6P39_22240) | 4856792..4858315 | + | 1524 | WP_275608578.1 | fumarate hydratase | - |
| O6P39_RS22245 (O6P39_22245) | 4858555..4858857 | - | 303 | WP_275608579.1 | ribbon-helix-helix domain-containing protein | - |
| O6P39_RS22250 (O6P39_22250) | 4858891..4859472 | - | 582 | WP_275608580.1 | DJ-1/PfpI family protein | - |
| O6P39_RS22255 (O6P39_22255) | 4859579..4860157 | - | 579 | WP_275608581.1 | DUF2846 domain-containing protein | - |
| O6P39_RS22260 (O6P39_22260) | 4860346..4860615 | + | 270 | WP_275608582.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| O6P39_RS22265 (O6P39_22265) | 4860606..4860893 | + | 288 | WP_275608583.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| O6P39_RS22270 (O6P39_22270) | 4860887..4861777 | - | 891 | WP_275608584.1 | carbon-nitrogen hydrolase family protein | - |
| O6P39_RS22275 (O6P39_22275) | 4861777..4862370 | - | 594 | WP_275608585.1 | GNAT family acetyltransferase | - |
| O6P39_RS22280 (O6P39_22280) | 4862480..4862878 | + | 399 | WP_275608586.1 | nuclear transport factor 2 family protein | - |
| O6P39_RS22285 (O6P39_22285) | 4863180..4864460 | - | 1281 | WP_275608587.1 | acyltransferase | - |
| O6P39_RS22290 (O6P39_22290) | 4864505..4865662 | - | 1158 | WP_275608588.1 | phospholipase D-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10890.54 Da Isoelectric Point: 9.9124
>T267247 WP_275608583.1 NZ_CP115669:4860606-4860893 [Pseudomonas sp. PSE14]
MRVIYAPAALRDLERLRRFLRETNPTAARRAGQIILQATQALGAHPQMGRLIDDLPVVYREWPIDFGDSGYLARYRIDGE
TLVVLAIRHQREAGY
MRVIYAPAALRDLERLRRFLRETNPTAARRAGQIILQATQALGAHPQMGRLIDDLPVVYREWPIDFGDSGYLARYRIDGE
TLVVLAIRHQREAGY
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|