Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/-
Location 2227918..2228470 Replicon chromosome
Accession NZ_CP115668
Organism Cutibacterium sp. CBA3108

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag O6R08_RS10105 Protein ID WP_271417988.1
Coordinates 2228231..2228470 (+) Length 80 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID -
Locus tag O6R08_RS10100 Protein ID WP_271417987.1
Coordinates 2227918..2228151 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O6R08_RS10090 (O6R08_10090) 2224315..2226843 + 2529 WP_271417985.1 transglycosylase domain-containing protein -
O6R08_RS10095 (O6R08_10095) 2226845..2227747 + 903 WP_271417986.1 metallophosphoesterase -
O6R08_RS10100 (O6R08_10100) 2227918..2228151 + 234 WP_271417987.1 ribbon-helix-helix domain-containing protein Antitoxin
O6R08_RS10105 (O6R08_10105) 2228231..2228470 + 240 WP_271417988.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
O6R08_RS10115 (O6R08_10115) 2228742..2229506 + 765 WP_271417989.1 YaaA family protein -
O6R08_RS10120 (O6R08_10120) 2229781..2230026 - 246 WP_271417990.1 type B 50S ribosomal protein L31 -
O6R08_RS10125 (O6R08_10125) 2230136..2230372 + 237 WP_271417991.1 50S ribosomal protein L28 -
O6R08_RS10130 (O6R08_10130) 2230372..2230542 + 171 WP_002528180.1 50S ribosomal protein L33 -
O6R08_RS10135 (O6R08_10135) 2230542..2230847 + 306 WP_271417992.1 30S ribosomal protein S14 -
O6R08_RS10140 (O6R08_10140) 2230852..2231022 + 171 WP_271417993.1 50S ribosomal protein L32 -
O6R08_RS10145 (O6R08_10145) 2231097..2231462 + 366 WP_271417994.1 FKBP-type peptidyl-prolyl cis-trans isomerase -
O6R08_RS10150 (O6R08_10150) 2231487..2232101 + 615 WP_271417995.1 nucleoside/nucleotide kinase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 80 a.a.        Molecular weight: 8377.69 Da        Isoelectric Point: 4.5605

>T267242 WP_271417988.1 NZ_CP115668:2228231-2228470 [Cutibacterium sp. CBA3108]
MTKVTVAPITSTLKGLSSEVPLDTRNGVDHACAASLDNVMTIPVSLLGRTVGFLRPEQEHDLAVAMVLAYDLEISILGN

Download         Length: 240 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8424.42 Da        Isoelectric Point: 4.0680

>AT267242 WP_271417987.1 NZ_CP115668:2227918-2228151 [Cutibacterium sp. CBA3108]
VTTQIAVRLPDELVRFLDQSVADGIVTSRAEMVSRAVEREMRHQAAVADAAILTTDGPRDDLDELVAWAATNAFLED

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References