Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/RHH(antitoxin) |
Location | 2765667..2766220 | Replicon | chromosome |
Accession | NZ_CP115663 | ||
Organism | Pseudomonas putida strain PD584_L3 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q88JZ3 |
Locus tag | PED35_RS12615 | Protein ID | WP_010953434.1 |
Coordinates | 2765927..2766220 (+) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q88JZ4 |
Locus tag | PED35_RS12610 | Protein ID | WP_010953433.1 |
Coordinates | 2765667..2765939 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PED35_RS12580 (PED35_12580) | 2761239..2761598 | - | 360 | Protein_2435 | JAB domain-containing protein | - |
PED35_RS12585 (PED35_12585) | 2761570..2762520 | - | 951 | WP_031299400.1 | hypothetical protein | - |
PED35_RS12590 (PED35_12590) | 2762613..2763617 | - | 1005 | WP_010953429.1 | YqaJ viral recombinase family protein | - |
PED35_RS12595 (PED35_12595) | 2763697..2764665 | - | 969 | WP_031299399.1 | DUF932 domain-containing protein | - |
PED35_RS12600 (PED35_12600) | 2764763..2765092 | - | 330 | WP_010953431.1 | hypothetical protein | - |
PED35_RS12605 (PED35_12605) | 2765297..2765542 | + | 246 | WP_010953432.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
PED35_RS12610 (PED35_12610) | 2765667..2765939 | + | 273 | WP_010953433.1 | CopG family ribbon-helix-helix protein | Antitoxin |
PED35_RS12615 (PED35_12615) | 2765927..2766220 | + | 294 | WP_010953434.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PED35_RS12620 (PED35_12620) | 2766214..2767623 | - | 1410 | WP_010953435.1 | site-specific integrase | - |
PED35_RS12625 (PED35_12625) | 2768146..2769072 | - | 927 | WP_010953436.1 | LysR family transcriptional regulator | - |
PED35_RS12630 (PED35_12630) | 2769186..2769917 | + | 732 | WP_010953437.1 | SDR family NAD(P)-dependent oxidoreductase | - |
PED35_RS12635 (PED35_12635) | 2769987..2770196 | + | 210 | WP_010953438.1 | 4-oxalocrotonate tautomerase family protein | - |
PED35_RS12640 (PED35_12640) | 2770193..2770405 | + | 213 | WP_061405625.1 | hypothetical protein | - |
PED35_RS12645 (PED35_12645) | 2770548..2771066 | + | 519 | WP_049587643.1 | DUF1993 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11155.61 Da Isoelectric Point: 5.9081
>T267231 WP_010953434.1 NZ_CP115663:2765927-2766220 [Pseudomonas putida]
VPRLIVTEGAAKGLERCRRFLSDKDPQVARRAAQAIERQFARLEESPEVGRPFPDLPELRELIIEFGDSGYVALYRYERA
DDTAYVLAFRHQKEAGY
VPRLIVTEGAAKGLERCRRFLSDKDPQVARRAAQAIERQFARLEESPEVGRPFPDLPELRELIIEFGDSGYVALYRYERA
DDTAYVLAFRHQKEAGY
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2W5CNE8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q88JZ4 |