Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relB-parE/RHH(antitoxin) |
| Location | 2763962..2764515 | Replicon | chromosome |
| Accession | NZ_CP115661 | ||
| Organism | Pseudomonas putida strain PD689_delTT1 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | Q88JZ3 |
| Locus tag | PED36_RS12620 | Protein ID | WP_010953434.1 |
| Coordinates | 2764222..2764515 (+) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | Q88JZ4 |
| Locus tag | PED36_RS12615 | Protein ID | WP_010953433.1 |
| Coordinates | 2763962..2764234 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PED36_RS12585 (PED36_12585) | 2759534..2759893 | - | 360 | Protein_2439 | JAB domain-containing protein | - |
| PED36_RS12590 (PED36_12590) | 2759865..2760815 | - | 951 | WP_031299400.1 | hypothetical protein | - |
| PED36_RS12595 (PED36_12595) | 2760908..2761912 | - | 1005 | WP_010953429.1 | YqaJ viral recombinase family protein | - |
| PED36_RS12600 (PED36_12600) | 2761992..2762960 | - | 969 | WP_031299399.1 | DUF932 domain-containing protein | - |
| PED36_RS12605 (PED36_12605) | 2763058..2763387 | - | 330 | WP_010953431.1 | hypothetical protein | - |
| PED36_RS12610 (PED36_12610) | 2763592..2763837 | + | 246 | WP_010953432.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| PED36_RS12615 (PED36_12615) | 2763962..2764234 | + | 273 | WP_010953433.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| PED36_RS12620 (PED36_12620) | 2764222..2764515 | + | 294 | WP_010953434.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PED36_RS12625 (PED36_12625) | 2764509..2765918 | - | 1410 | WP_010953435.1 | site-specific integrase | - |
| PED36_RS12630 (PED36_12630) | 2766441..2767367 | - | 927 | WP_010953436.1 | LysR family transcriptional regulator | - |
| PED36_RS12635 (PED36_12635) | 2767481..2768212 | + | 732 | WP_010953437.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| PED36_RS12640 (PED36_12640) | 2768282..2768491 | + | 210 | WP_010953438.1 | 4-oxalocrotonate tautomerase family protein | - |
| PED36_RS12645 (PED36_12645) | 2768488..2768700 | + | 213 | WP_061405625.1 | hypothetical protein | - |
| PED36_RS12650 (PED36_12650) | 2768843..2769361 | + | 519 | WP_049587643.1 | DUF1993 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11155.61 Da Isoelectric Point: 5.9081
>T267224 WP_010953434.1 NZ_CP115661:2764222-2764515 [Pseudomonas putida]
VPRLIVTEGAAKGLERCRRFLSDKDPQVARRAAQAIERQFARLEESPEVGRPFPDLPELRELIIEFGDSGYVALYRYERA
DDTAYVLAFRHQKEAGY
VPRLIVTEGAAKGLERCRRFLSDKDPQVARRAAQAIERQFARLEESPEVGRPFPDLPELRELIIEFGDSGYVALYRYERA
DDTAYVLAFRHQKEAGY
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2W5CNE8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q88JZ4 |