Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /RES-TIGR02293 |
Location | 2698246..2699129 | Replicon | chromosome |
Accession | NZ_CP115661 | ||
Organism | Pseudomonas putida strain PD689_delTT1 |
Toxin (Protein)
Gene name | - | Uniprot ID | Q88K57 |
Locus tag | PED36_RS12245 | Protein ID | WP_003250527.1 |
Coordinates | 2698692..2699129 (+) | Length | 146 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | I7C3Q7 |
Locus tag | PED36_RS12240 | Protein ID | WP_003250525.1 |
Coordinates | 2698246..2698695 (+) | Length | 150 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PED36_RS12215 (PED36_12215) | 2693670..2694869 | + | 1200 | WP_049587621.1 | sugar transporter | - |
PED36_RS12220 (PED36_12220) | 2694909..2695493 | - | 585 | WP_010953382.1 | LysE family transporter | - |
PED36_RS12225 (PED36_12225) | 2695544..2696374 | - | 831 | WP_003250518.1 | AraC family transcriptional regulator | - |
PED36_RS12230 (PED36_12230) | 2696423..2697346 | - | 924 | WP_010953383.1 | LysR family transcriptional regulator | - |
PED36_RS12235 (PED36_12235) | 2697450..2698103 | + | 654 | WP_010953384.1 | oxygen-insensitive NAD(P)H-dependent nitroreductase NfsB | - |
PED36_RS12240 (PED36_12240) | 2698246..2698695 | + | 450 | WP_003250525.1 | DUF2384 domain-containing protein | Antitoxin |
PED36_RS12245 (PED36_12245) | 2698692..2699129 | + | 438 | WP_003250527.1 | RES family NAD+ phosphorylase | Toxin |
PED36_RS12250 (PED36_12250) | 2699137..2700291 | - | 1155 | WP_049587669.1 | aminotransferase class V-fold PLP-dependent enzyme | - |
PED36_RS12255 (PED36_12255) | 2700485..2701411 | - | 927 | WP_010953387.1 | LysR family transcriptional regulator | - |
PED36_RS12260 (PED36_12260) | 2701552..2702781 | + | 1230 | WP_049587623.1 | acyl-CoA dehydrogenase | - |
PED36_RS12265 (PED36_12265) | 2702945..2703193 | + | 249 | Protein_2378 | PAAR domain-containing protein | - |
PED36_RS12270 (PED36_12270) | 2703196..2703585 | + | 390 | WP_049587628.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 146 a.a. Molecular weight: 15990.29 Da Isoelectric Point: 5.6007
>T267223 WP_003250527.1 NZ_CP115661:2698692-2699129 [Pseudomonas putida]
VILWRISAYADLSGTGGLRVSGRWHQAGRPVVYAATSPPGAMLEVLVHLEIDPEDFPTTMRLLRIELPDTVSQAQLPALQ
PGWSAQPELTRTLGNRFLDDCSALLLPVPSAIMPSTTNYLFNPRHPQAQSAKIQVEDFTPDSRLF
VILWRISAYADLSGTGGLRVSGRWHQAGRPVVYAATSPPGAMLEVLVHLEIDPEDFPTTMRLLRIELPDTVSQAQLPALQ
PGWSAQPELTRTLGNRFLDDCSALLLPVPSAIMPSTTNYLFNPRHPQAQSAKIQVEDFTPDSRLF
Download Length: 438 bp
Antitoxin
Download Length: 150 a.a. Molecular weight: 16956.46 Da Isoelectric Point: 5.7258
>AT267223 WP_003250525.1 NZ_CP115661:2698246-2698695 [Pseudomonas putida]
MLAEVLRDNGYHEYRARLQALLDIPELASDFEIHTRITDGFAATWLVKLTERGVLTPVERDQIIPLRTLKSRIERDQPLT
VDESDRLFRSAHITAMAEAVFGEAGKAKRWLSKPKERFSGLTPMQMLTTQQGTTQVEEMLLQIAEGYGL
MLAEVLRDNGYHEYRARLQALLDIPELASDFEIHTRITDGFAATWLVKLTERGVLTPVERDQIIPLRTLKSRIERDQPLT
VDESDRLFRSAHITAMAEAVFGEAGKAKRWLSKPKERFSGLTPMQMLTTQQGTTQVEEMLLQIAEGYGL
Download Length: 450 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|