Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-higA/HigB-HigA |
| Location | 328591..329582 | Replicon | chromosome |
| Accession | NZ_CP115661 | ||
| Organism | Pseudomonas putida strain PD689_delTT1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PED36_RS01440 | Protein ID | WP_020190010.1 |
| Coordinates | 328591..329067 (+) | Length | 159 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | Q88R60 |
| Locus tag | PED36_RS01445 | Protein ID | WP_004575922.1 |
| Coordinates | 329109..329582 (+) | Length | 158 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PED36_RS01420 (PED36_01420) | 323734..325101 | - | 1368 | WP_010951639.1 | ATP-binding protein | - |
| PED36_RS01425 (PED36_01425) | 325103..325822 | - | 720 | WP_010951640.1 | response regulator | - |
| PED36_RS01430 (PED36_01430) | 325963..328260 | + | 2298 | WP_010951641.1 | TonB-dependent siderophore receptor | - |
| PED36_RS01435 (PED36_01435) | 328326..328532 | - | 207 | WP_014860378.1 | DUF3079 domain-containing protein | - |
| PED36_RS01440 (PED36_01440) | 328591..329067 | + | 477 | WP_020190010.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PED36_RS01445 (PED36_01445) | 329109..329582 | + | 474 | WP_004575922.1 | transcriptional regulator | Antitoxin |
| PED36_RS01450 (PED36_01450) | 329587..329774 | - | 188 | Protein_282 | integrase | - |
| PED36_RS01455 (PED36_01455) | 330002..330217 | + | 216 | WP_010951644.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| PED36_RS01460 (PED36_01460) | 330214..330537 | - | 324 | WP_010951645.1 | helix-turn-helix transcriptional regulator | - |
| PED36_RS01470 (PED36_01470) | 330999..331247 | - | 249 | WP_010951646.1 | hypothetical protein | - |
| PED36_RS01475 (PED36_01475) | 331768..332043 | + | 276 | WP_049588069.1 | DUF3077 domain-containing protein | - |
| PED36_RS01480 (PED36_01480) | 332398..333603 | - | 1206 | WP_010951648.1 | methyltransferase | - |
| PED36_RS01485 (PED36_01485) | 333732..334421 | - | 690 | WP_010951649.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 159 a.a. Molecular weight: 18386.38 Da Isoelectric Point: 10.3522
>T267220 WP_020190010.1 NZ_CP115661:328591-329067 [Pseudomonas putida]
MTGINPLAIARSPYIAHPDIWLTDIWIGDIFHPMLVRRDNTMRVITKAAVTKAIEVHGQWKAPLSLWLTTFDRATLRFES
FEQLRQTWATVSGWNVDRIPHSKLRPASRKGPLDIYVFDIKKNECRLIAWLNARTGTLYIKAILSHAEYDKWCRSDIR
MTGINPLAIARSPYIAHPDIWLTDIWIGDIFHPMLVRRDNTMRVITKAAVTKAIEVHGQWKAPLSLWLTTFDRATLRFES
FEQLRQTWATVSGWNVDRIPHSKLRPASRKGPLDIYVFDIKKNECRLIAWLNARTGTLYIKAILSHAEYDKWCRSDIR
Download Length: 477 bp
Antitoxin
Download Length: 158 a.a. Molecular weight: 17229.67 Da Isoelectric Point: 4.4982
>AT267220 WP_004575922.1 NZ_CP115661:329109-329582 [Pseudomonas putida]
MKRDKIEANGLDAFIANISPMLDGLNTQMATMAQLLAACHDPIKDDAELEARMALIDELYSHADSEGHAAARFAEMVADR
VYEYESESVLVPFASQAEALAFLLSDRGVKQKDLSAIATQSAVSEILNNKRKMTVAQIKGFAEFFSVPVEFFMHGVV
MKRDKIEANGLDAFIANISPMLDGLNTQMATMAQLLAACHDPIKDDAELEARMALIDELYSHADSEGHAAARFAEMVADR
VYEYESESVLVPFASQAEALAFLLSDRGVKQKDLSAIATQSAVSEILNNKRKMTVAQIKGFAEFFSVPVEFFMHGVV
Download Length: 474 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|