Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
Location | 4427313..4427877 | Replicon | chromosome |
Accession | NZ_CP115659 | ||
Organism | Kosakonia oryzendophytica strain FY-07 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | O9K67_RS21330 | Protein ID | WP_245191397.1 |
Coordinates | 4427313..4427621 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A1C4A1Z8 |
Locus tag | O9K67_RS21335 | Protein ID | WP_061497949.1 |
Coordinates | 4427605..4427877 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O9K67_RS21305 (O9K67_21305) | 4423404..4423871 | - | 468 | WP_061497942.1 | YjiG family protein | - |
O9K67_RS21310 (O9K67_21310) | 4423864..4424547 | - | 684 | WP_061497944.1 | nucleoside recognition domain-containing protein | - |
O9K67_RS21315 (O9K67_21315) | 4424925..4425821 | + | 897 | WP_061497946.1 | LysR substrate-binding domain-containing protein | - |
O9K67_RS21320 (O9K67_21320) | 4425864..4426634 | + | 771 | WP_061497947.1 | AraC family transcriptional regulator | - |
O9K67_RS21325 (O9K67_21325) | 4426684..4427307 | + | 624 | WP_061497948.1 | LysE family translocator | - |
O9K67_RS21330 (O9K67_21330) | 4427313..4427621 | - | 309 | WP_245191397.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
O9K67_RS21335 (O9K67_21335) | 4427605..4427877 | - | 273 | WP_061497949.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
O9K67_RS21340 (O9K67_21340) | 4427963..4429243 | + | 1281 | WP_061497950.1 | DUF445 domain-containing protein | - |
O9K67_RS21345 (O9K67_21345) | 4429264..4429503 | + | 240 | WP_061497952.1 | DUF2164 domain-containing protein | - |
O9K67_RS21350 (O9K67_21350) | 4429623..4430774 | + | 1152 | WP_061497954.1 | double-cubane-cluster-containing anaerobic reductase | - |
O9K67_RS21355 (O9K67_21355) | 4430784..4431554 | + | 771 | WP_061497956.1 | putative 2-hydroxyacyl-CoA dehydratase activator YjiL | - |
O9K67_RS21360 (O9K67_21360) | 4431547..4431783 | + | 237 | WP_061497959.1 | DUF3343 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11577.32 Da Isoelectric Point: 9.3067
>T267219 WP_245191397.1 NZ_CP115659:c4427621-4427313 [Kosakonia oryzendophytica]
MMGKSKRAPLPYRSDYTKTFVKAWARYNKAGRRDMHETAAIMSMVLSGNPLPAQYSDHALTGNMLGFRELHLGGDYLLVY
RVDEAKHLVVFTDLGTHAELFE
MMGKSKRAPLPYRSDYTKTFVKAWARYNKAGRRDMHETAAIMSMVLSGNPLPAQYSDHALTGNMLGFRELHLGGDYLLVY
RVDEAKHLVVFTDLGTHAELFE
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|