Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /RES-TIGR02293 |
| Location | 3346943..3347859 | Replicon | chromosome |
| Accession | NZ_CP115659 | ||
| Organism | Kosakonia oryzendophytica strain FY-07 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | A0A1C4B0H3 |
| Locus tag | O9K67_RS16240 | Protein ID | WP_061494660.1 |
| Coordinates | 3347383..3347859 (+) | Length | 159 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | O9K67_RS16235 | Protein ID | WP_061494661.1 |
| Coordinates | 3346943..3347386 (+) | Length | 148 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O9K67_RS16210 (O9K67_16210) | 3341980..3343746 | + | 1767 | WP_061494664.1 | cysteine/glutathione ABC transporter permease/ATP-binding protein CydD | - |
| O9K67_RS16215 (O9K67_16215) | 3343747..3345468 | + | 1722 | WP_061494663.1 | cysteine/glutathione ABC transporter ATP-binding protein/permease CydC | - |
| O9K67_RS16220 (O9K67_16220) | 3345576..3346277 | + | 702 | WP_061494662.1 | leucyl/phenylalanyl-tRNA--protein transferase | - |
| O9K67_RS16225 (O9K67_16225) | 3346469..3346638 | + | 170 | Protein_3192 | hypothetical protein | - |
| O9K67_RS16230 (O9K67_16230) | 3346566..3346784 | + | 219 | WP_001040187.1 | translation initiation factor IF-1 | - |
| O9K67_RS16235 (O9K67_16235) | 3346943..3347386 | + | 444 | WP_061494661.1 | DUF2384 domain-containing protein | Antitoxin |
| O9K67_RS16240 (O9K67_16240) | 3347383..3347859 | + | 477 | WP_061494660.1 | RES domain-containing protein | Toxin |
| O9K67_RS16245 (O9K67_16245) | 3347976..3349364 | + | 1389 | WP_061499941.1 | diguanylate cyclase | - |
| O9K67_RS16250 (O9K67_16250) | 3349454..3351742 | - | 2289 | WP_061494659.1 | ATP-dependent Clp protease ATP-binding subunit ClpA | - |
| O9K67_RS16255 (O9K67_16255) | 3351774..3352094 | - | 321 | WP_061494658.1 | ATP-dependent Clp protease adapter ClpS | - |
| O9K67_RS16260 (O9K67_16260) | 3352423..3352644 | + | 222 | WP_061494657.1 | cold shock-like protein CspD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 159 a.a. Molecular weight: 17605.08 Da Isoelectric Point: 5.8818
>T267216 WP_061494660.1 NZ_CP115659:3347383-3347859 [Kosakonia oryzendophytica]
MIFYRLVTHRYASEAWTGSGANLFGGRWNHKGHPAVYVASSISLAALEMLVHVHSDTVLTQYGLFSIEIPDNDIEYLDKQ
WLPPDWQENPAPLSTMDLGTAWLEANSGVALVLPSCVVPLENNAMLNPQHPTFSQLLKTVKALPFSFDARLVNQTTLR
MIFYRLVTHRYASEAWTGSGANLFGGRWNHKGHPAVYVASSISLAALEMLVHVHSDTVLTQYGLFSIEIPDNDIEYLDKQ
WLPPDWQENPAPLSTMDLGTAWLEANSGVALVLPSCVVPLENNAMLNPQHPTFSQLLKTVKALPFSFDARLVNQTTLR
Download Length: 477 bp
Antitoxin
Download Length: 148 a.a. Molecular weight: 16381.82 Da Isoelectric Point: 8.6778
>AT267216 WP_061494661.1 NZ_CP115659:3346943-3347386 [Kosakonia oryzendophytica]
MRTWSPDQKPAENALWRFAGFPANRGLKLVQMLNEGLPVSILDNIHEWTEMSLSDILRVTGINERNVARRKSTGRTLTPE
ESERIARLVRVVDAAVQFFGNKKMAYDWLQAPVRGLGNVAPISLIATESGALEVTDLIGRLEHGVFA
MRTWSPDQKPAENALWRFAGFPANRGLKLVQMLNEGLPVSILDNIHEWTEMSLSDILRVTGINERNVARRKSTGRTLTPE
ESERIARLVRVVDAAVQFFGNKKMAYDWLQAPVRGLGNVAPISLIATESGALEVTDLIGRLEHGVFA
Download Length: 444 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|