Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 866269..866932 | Replicon | chromosome |
| Accession | NZ_CP115659 | ||
| Organism | Kosakonia oryzendophytica strain FY-07 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A1C4CSM5 |
| Locus tag | O9K67_RS04200 | Protein ID | WP_061493250.1 |
| Coordinates | 866516..866932 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A1C4CSA8 |
| Locus tag | O9K67_RS04195 | Protein ID | WP_061493249.1 |
| Coordinates | 866269..866535 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O9K67_RS04175 (O9K67_04175) | 861815..863248 | - | 1434 | WP_061493244.1 | 6-phospho-beta-glucosidase | - |
| O9K67_RS04180 (O9K67_04180) | 863365..864093 | - | 729 | WP_061493245.1 | MurR/RpiR family transcriptional regulator | - |
| O9K67_RS04185 (O9K67_04185) | 864332..864991 | + | 660 | WP_061493246.1 | hemolysin III family protein | - |
| O9K67_RS04190 (O9K67_04190) | 865037..866020 | - | 984 | WP_061493247.1 | tRNA-modifying protein YgfZ | - |
| O9K67_RS04195 (O9K67_04195) | 866269..866535 | + | 267 | WP_061493249.1 | FAD assembly factor SdhE | Antitoxin |
| O9K67_RS04200 (O9K67_04200) | 866516..866932 | + | 417 | WP_061493250.1 | protein YgfX | Toxin |
| O9K67_RS04205 (O9K67_04205) | 866951..867472 | - | 522 | WP_061493251.1 | flavodoxin FldB | - |
| O9K67_RS04210 (O9K67_04210) | 867571..868467 | + | 897 | WP_061493252.1 | site-specific tyrosine recombinase XerD | - |
| O9K67_RS04215 (O9K67_04215) | 868491..869204 | + | 714 | WP_061493253.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| O9K67_RS04220 (O9K67_04220) | 869210..870943 | + | 1734 | WP_061493254.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 16321.25 Da Isoelectric Point: 11.4778
>T267211 WP_061493250.1 NZ_CP115659:866516-866932 [Kosakonia oryzendophytica]
VVLWQSDLRVSWRAQWLSLLLHGLVAALILLMPWPLSYTPLWLLLLSLVVFDSVRSQRRINACHGEIKLLMESRLRWQGV
EWNIVGAPWMLRSGMMLRLRREEDGRRQHLWLAADSMDAQEWRDLRRMLSQKSAQGLH
VVLWQSDLRVSWRAQWLSLLLHGLVAALILLMPWPLSYTPLWLLLLSLVVFDSVRSQRRINACHGEIKLLMESRLRWQGV
EWNIVGAPWMLRSGMMLRLRREEDGRRQHLWLAADSMDAQEWRDLRRMLSQKSAQGLH
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1C4CSM5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1C4CSA8 |