Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 74547..75181 | Replicon | chromosome |
Accession | NZ_CP115659 | ||
Organism | Kosakonia oryzendophytica strain FY-07 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A1C4E9S6 |
Locus tag | O9K67_RS00320 | Protein ID | WP_061492456.1 |
Coordinates | 74777..75181 (+) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A1C4E9Z4 |
Locus tag | O9K67_RS00315 | Protein ID | WP_061492455.1 |
Coordinates | 74547..74777 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O9K67_RS00290 (O9K67_00290) | 70535..71437 | + | 903 | WP_061492450.1 | WYL domain-containing protein | - |
O9K67_RS00295 (O9K67_00295) | 71465..71863 | - | 399 | WP_061492451.1 | cupin domain-containing protein | - |
O9K67_RS00300 (O9K67_00300) | 72210..72812 | - | 603 | WP_061492452.1 | XRE family transcriptional regulator | - |
O9K67_RS00305 (O9K67_00305) | 72858..73550 | + | 693 | WP_061492453.1 | B3/4 domain-containing protein | - |
O9K67_RS00310 (O9K67_00310) | 73564..74445 | + | 882 | WP_061492454.1 | dihydrodipicolinate synthase family protein | - |
O9K67_RS00315 (O9K67_00315) | 74547..74777 | + | 231 | WP_061492455.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
O9K67_RS00320 (O9K67_00320) | 74777..75181 | + | 405 | WP_061492456.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
O9K67_RS00325 (O9K67_00325) | 75187..76245 | - | 1059 | WP_061492457.1 | AbrB family transcriptional regulator | - |
O9K67_RS00330 (O9K67_00330) | 77122..77574 | + | 453 | WP_061492458.1 | phage tail protein | - |
O9K67_RS00335 (O9K67_00335) | 77590..78663 | + | 1074 | WP_061492459.1 | phage tail sheath C-terminal domain-containing protein | - |
O9K67_RS00340 (O9K67_00340) | 78681..80081 | + | 1401 | WP_061492460.1 | phage tail sheath subtilisin-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 70535..95919 | 25384 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15002.47 Da Isoelectric Point: 8.5131
>T267210 WP_061492456.1 NZ_CP115659:74777-75181 [Kosakonia oryzendophytica]
MLKFMLDTNICIFTIKNKPETVRRAFNQRDGQMCISSITLMELIYGAEKSAAPEKNLRVVEGFTARLEVLPYGIDASVHT
GQLRAELAREGAPIGPYDAMIGAHARSLGLILVTNNTREFVRIPGLRLQDWTMH
MLKFMLDTNICIFTIKNKPETVRRAFNQRDGQMCISSITLMELIYGAEKSAAPEKNLRVVEGFTARLEVLPYGIDASVHT
GQLRAELAREGAPIGPYDAMIGAHARSLGLILVTNNTREFVRIPGLRLQDWTMH
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1C4E9S6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1C4E9Z4 |