Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1592325..1593011 | Replicon | chromosome |
| Accession | NZ_CP115654 | ||
| Organism | Neisseria gonorrhoeae strain FA1090 N-1-60 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q5F6D1 |
| Locus tag | OK783_RS08260 | Protein ID | WP_003689143.1 |
| Coordinates | 1592829..1593011 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q5F6D2 |
| Locus tag | OK783_RS08255 | Protein ID | WP_003691454.1 |
| Coordinates | 1592325..1592726 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OK783_RS08205 (OK783_08205) | 1587801..1588016 | - | 216 | WP_003691538.1 | hypothetical protein | - |
| OK783_RS08210 (OK783_08210) | 1588068..1588559 | - | 492 | WP_004464807.1 | siphovirus Gp157 family protein | - |
| OK783_RS08215 (OK783_08215) | 1588556..1588738 | - | 183 | WP_003691535.1 | hypothetical protein | - |
| OK783_RS08220 (OK783_08220) | 1588878..1589564 | - | 687 | WP_010951053.1 | hypothetical protein | - |
| OK783_RS08225 (OK783_08225) | 1589633..1589794 | - | 162 | WP_003693867.1 | hypothetical protein | - |
| OK783_RS08230 (OK783_08230) | 1589791..1590066 | - | 276 | WP_003694990.1 | hypothetical protein | - |
| OK783_RS08235 (OK783_08235) | 1590219..1590551 | - | 333 | WP_003696914.1 | hypothetical protein | - |
| OK783_RS08240 (OK783_08240) | 1590692..1590892 | - | 201 | WP_003695499.1 | hypothetical protein | - |
| OK783_RS08245 (OK783_08245) | 1591133..1591549 | - | 417 | WP_003693479.1 | hypothetical protein | - |
| OK783_RS08250 (OK783_08250) | 1591558..1592142 | - | 585 | WP_003693477.1 | Panacea domain-containing protein | - |
| OK783_RS08255 (OK783_08255) | 1592325..1592726 | - | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| OK783_RS08260 (OK783_08260) | 1592829..1593011 | - | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| OK783_RS08265 (OK783_08265) | 1593181..1593999 | - | 819 | WP_003705996.1 | DUF3037 domain-containing protein | - |
| OK783_RS08270 (OK783_08270) | 1594272..1595027 | - | 756 | WP_003693472.1 | LexA family transcriptional regulator | - |
| OK783_RS08275 (OK783_08275) | 1595164..1595349 | + | 186 | WP_002238713.1 | Cro/CI family transcriptional regulator | - |
| OK783_RS08280 (OK783_08280) | 1595438..1595593 | + | 156 | WP_003689578.1 | hypothetical protein | - |
| OK783_RS08285 (OK783_08285) | 1595570..1595758 | - | 189 | WP_010951308.1 | hypothetical protein | - |
| OK783_RS08290 (OK783_08290) | 1595931..1596158 | + | 228 | WP_003691442.1 | helix-turn-helix domain-containing protein | - |
| OK783_RS08295 (OK783_08295) | 1596155..1596706 | + | 552 | WP_010951309.1 | helix-turn-helix domain-containing protein | - |
| OK783_RS08300 (OK783_08300) | 1596703..1597197 | + | 495 | WP_157147409.1 | hypothetical protein | - |
| OK783_RS08305 (OK783_08305) | 1597213..1597992 | + | 780 | WP_025455898.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1576811..1610602 | 33791 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6687.77 Da Isoelectric Point: 10.7235
>T267209 WP_003689143.1 NZ_CP115654:c1593011-1592829 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14634.43 Da Isoelectric Point: 4.5457
>AT267209 WP_003691454.1 NZ_CP115654:c1592726-1592325 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|