Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1592325..1593011 Replicon chromosome
Accession NZ_CP115654
Organism Neisseria gonorrhoeae strain FA1090 N-1-60

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag OK783_RS08260 Protein ID WP_003689143.1
Coordinates 1592829..1593011 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag OK783_RS08255 Protein ID WP_003691454.1
Coordinates 1592325..1592726 (-) Length 134 a.a.

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OK783_RS08205 (OK783_08205) 1587801..1588016 - 216 WP_003691538.1 hypothetical protein -
OK783_RS08210 (OK783_08210) 1588068..1588559 - 492 WP_004464807.1 siphovirus Gp157 family protein -
OK783_RS08215 (OK783_08215) 1588556..1588738 - 183 WP_003691535.1 hypothetical protein -
OK783_RS08220 (OK783_08220) 1588878..1589564 - 687 WP_010951053.1 hypothetical protein -
OK783_RS08225 (OK783_08225) 1589633..1589794 - 162 WP_003693867.1 hypothetical protein -
OK783_RS08230 (OK783_08230) 1589791..1590066 - 276 WP_003694990.1 hypothetical protein -
OK783_RS08235 (OK783_08235) 1590219..1590551 - 333 WP_003696914.1 hypothetical protein -
OK783_RS08240 (OK783_08240) 1590692..1590892 - 201 WP_003695499.1 hypothetical protein -
OK783_RS08245 (OK783_08245) 1591133..1591549 - 417 WP_003693479.1 hypothetical protein -
OK783_RS08250 (OK783_08250) 1591558..1592142 - 585 WP_003693477.1 Panacea domain-containing protein -
OK783_RS08255 (OK783_08255) 1592325..1592726 - 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
OK783_RS08260 (OK783_08260) 1592829..1593011 - 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
OK783_RS08265 (OK783_08265) 1593181..1593999 - 819 WP_003705996.1 DUF3037 domain-containing protein -
OK783_RS08270 (OK783_08270) 1594272..1595027 - 756 WP_003693472.1 LexA family transcriptional regulator -
OK783_RS08275 (OK783_08275) 1595164..1595349 + 186 WP_002238713.1 Cro/CI family transcriptional regulator -
OK783_RS08280 (OK783_08280) 1595438..1595593 + 156 WP_003689578.1 hypothetical protein -
OK783_RS08285 (OK783_08285) 1595570..1595758 - 189 WP_010951308.1 hypothetical protein -
OK783_RS08290 (OK783_08290) 1595931..1596158 + 228 WP_003691442.1 helix-turn-helix domain-containing protein -
OK783_RS08295 (OK783_08295) 1596155..1596706 + 552 WP_010951309.1 helix-turn-helix domain-containing protein -
OK783_RS08300 (OK783_08300) 1596703..1597197 + 495 WP_157147409.1 hypothetical protein -
OK783_RS08305 (OK783_08305) 1597213..1597992 + 780 WP_025455898.1 ATP-binding protein -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1576811..1610602 33791


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.



Sequences


Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T267209 WP_003689143.1 NZ_CP115654:c1593011-1592829 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp


Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT267209 WP_003691454.1 NZ_CP115654:c1592726-1592325 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB Q5F6D1


Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References