Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 887271..887926 | Replicon | chromosome |
| Accession | NZ_CP115654 | ||
| Organism | Neisseria gonorrhoeae strain FA1090 N-1-60 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | Q5F882 |
| Locus tag | OK783_RS04610 | Protein ID | WP_003691083.1 |
| Coordinates | 887271..887690 (-) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | Q5F881 |
| Locus tag | OK783_RS04615 | Protein ID | WP_003688410.1 |
| Coordinates | 887690..887926 (-) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OK783_RS04590 (OK783_04590) | 882505..884046 | - | 1542 | WP_003688418.1 | MDR family MFS transporter | - |
| OK783_RS04595 (OK783_04595) | 884194..884973 | + | 780 | WP_003702609.1 | (Fe-S)-binding protein | - |
| OK783_RS04600 (OK783_04600) | 884970..885671 | + | 702 | WP_003688414.1 | lactate utilization protein C | - |
| OK783_RS04605 (OK783_04605) | 885668..887122 | + | 1455 | WP_003688412.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
| OK783_RS04610 (OK783_04610) | 887271..887690 | - | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
| OK783_RS04615 (OK783_04615) | 887690..887926 | - | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
| OK783_RS04620 (OK783_04620) | 888132..888953 | - | 822 | WP_003706481.1 | IS3 family transposase | - |
| OK783_RS04625 (OK783_04625) | 888958..889359 | - | 402 | WP_020997337.1 | helix-turn-helix domain-containing protein | - |
| OK783_RS04630 (OK783_04630) | 889598..889984 | + | 387 | Protein_908 | IS110 family transposase | - |
| OK783_RS04635 (OK783_04635) | 890367..891257 | - | 891 | WP_003693285.1 | succinate--CoA ligase subunit alpha | - |
| OK783_RS04640 (OK783_04640) | 891268..892434 | - | 1167 | WP_003701280.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| OK783_RS04645 (OK783_04645) | 892506..892793 | - | 288 | WP_003688407.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 889577..890050 | 473 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T267208 WP_003691083.1 NZ_CP115654:c887690-887271 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|