Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 549314..549967 | Replicon | chromosome |
Accession | NZ_CP115645 | ||
Organism | Acinetobacter baumannii strain 2022CK-00371 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | PF555_RS02615 | Protein ID | WP_000607070.1 |
Coordinates | 549578..549967 (+) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V5V966 |
Locus tag | PF555_RS02610 | Protein ID | WP_001288210.1 |
Coordinates | 549314..549571 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PF555_RS02590 (PF555_02590) | 544830..545837 | + | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
PF555_RS02595 (PF555_02595) | 545856..546233 | + | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
PF555_RS02600 (PF555_02600) | 546414..547904 | + | 1491 | WP_000415133.1 | NAD(P)/FAD-dependent oxidoreductase | - |
PF555_RS02605 (PF555_02605) | 547954..549126 | - | 1173 | WP_001190546.1 | acyl-CoA dehydrogenase family protein | - |
PF555_RS02610 (PF555_02610) | 549314..549571 | + | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
PF555_RS02615 (PF555_02615) | 549578..549967 | + | 390 | WP_000607070.1 | hypothetical protein | Toxin |
PF555_RS02620 (PF555_02620) | 550737..551822 | + | 1086 | WP_000049107.1 | hypothetical protein | - |
PF555_RS02625 (PF555_02625) | 551900..552466 | + | 567 | WP_000651536.1 | rhombosortase | - |
PF555_RS02630 (PF555_02630) | 552654..554849 | + | 2196 | WP_001158905.1 | TRAP transporter large permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15708.02 Da Isoelectric Point: 10.3599
>T267207 WP_000607070.1 NZ_CP115645:549578-549967 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAKIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEDHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAKIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEDHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|