Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 3422280..3422933 | Replicon | chromosome |
Accession | NZ_CP115641 | ||
Organism | Acinetobacter baumannii strain 2022CK-00251 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | PF550_RS16335 | Protein ID | WP_000607070.1 |
Coordinates | 3422280..3422669 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V5V966 |
Locus tag | PF550_RS16340 | Protein ID | WP_001288210.1 |
Coordinates | 3422676..3422933 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PF550_RS16320 (PF550_16320) | 3417398..3419593 | - | 2196 | WP_001158905.1 | TRAP transporter large permease subunit | - |
PF550_RS16325 (PF550_16325) | 3419781..3420347 | - | 567 | WP_000651536.1 | rhombosortase | - |
PF550_RS16330 (PF550_16330) | 3420425..3421510 | - | 1086 | WP_000049107.1 | hypothetical protein | - |
PF550_RS16335 (PF550_16335) | 3422280..3422669 | - | 390 | WP_000607070.1 | hypothetical protein | Toxin |
PF550_RS16340 (PF550_16340) | 3422676..3422933 | - | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
PF550_RS16345 (PF550_16345) | 3423121..3424293 | + | 1173 | WP_001190546.1 | acyl-CoA dehydrogenase family protein | - |
PF550_RS16350 (PF550_16350) | 3424343..3425833 | - | 1491 | WP_000415133.1 | NAD(P)/FAD-dependent oxidoreductase | - |
PF550_RS16355 (PF550_16355) | 3426014..3426391 | - | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
PF550_RS16360 (PF550_16360) | 3426410..3427417 | - | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15708.02 Da Isoelectric Point: 10.3599
>T267205 WP_000607070.1 NZ_CP115641:c3422669-3422280 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAKIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEDHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAKIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEDHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|