Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 463885..464538 | Replicon | chromosome |
Accession | NZ_CP115632 | ||
Organism | Acinetobacter baumannii strain 2022CK-00063 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | PF552_RS02255 | Protein ID | WP_025467596.1 |
Coordinates | 464149..464538 (+) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V5V966 |
Locus tag | PF552_RS02250 | Protein ID | WP_001288210.1 |
Coordinates | 463885..464142 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PF552_RS02230 (PF552_02230) | 459401..460408 | + | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
PF552_RS02235 (PF552_02235) | 460427..460804 | + | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
PF552_RS02240 (PF552_02240) | 460986..462476 | + | 1491 | WP_000415133.1 | NAD(P)/FAD-dependent oxidoreductase | - |
PF552_RS02245 (PF552_02245) | 462525..463697 | - | 1173 | WP_031961342.1 | acyl-CoA dehydrogenase family protein | - |
PF552_RS02250 (PF552_02250) | 463885..464142 | + | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
PF552_RS02255 (PF552_02255) | 464149..464538 | + | 390 | WP_025467596.1 | membrane protein | Toxin |
PF552_RS02260 (PF552_02260) | 465308..466393 | + | 1086 | WP_000049106.1 | hypothetical protein | - |
PF552_RS02265 (PF552_02265) | 466471..467037 | + | 567 | WP_281714832.1 | rhombosortase | - |
PF552_RS02270 (PF552_02270) | 467225..469420 | + | 2196 | WP_001158905.1 | TRAP transporter large permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15609.84 Da Isoelectric Point: 10.3816
>T267201 WP_025467596.1 NZ_CP115632:464149-464538 [Acinetobacter baumannii]
MINHLNFQLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLH
MINHLNFQLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLH
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|