Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 3477561..3478214 | Replicon | chromosome |
Accession | NZ_CP115623 | ||
Organism | Acinetobacter baumannii strain 2022CK-00340 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | PF449_RS16660 | Protein ID | WP_025467596.1 |
Coordinates | 3477561..3477950 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V5V966 |
Locus tag | PF449_RS16665 | Protein ID | WP_001288210.1 |
Coordinates | 3477957..3478214 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PF449_RS16645 (PF449_16645) | 3472679..3474874 | - | 2196 | WP_001158905.1 | TRAP transporter large permease subunit | - |
PF449_RS16650 (PF449_16650) | 3475062..3475628 | - | 567 | WP_000651536.1 | rhombosortase | - |
PF449_RS16655 (PF449_16655) | 3475706..3476791 | - | 1086 | WP_000049106.1 | hypothetical protein | - |
PF449_RS16660 (PF449_16660) | 3477561..3477950 | - | 390 | WP_025467596.1 | membrane protein | Toxin |
PF449_RS16665 (PF449_16665) | 3477957..3478214 | - | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
PF449_RS16670 (PF449_16670) | 3478402..3479574 | + | 1173 | WP_031961342.1 | acyl-CoA dehydrogenase family protein | - |
PF449_RS16675 (PF449_16675) | 3479623..3481113 | - | 1491 | WP_000415133.1 | NAD(P)/FAD-dependent oxidoreductase | - |
PF449_RS16680 (PF449_16680) | 3481295..3481672 | - | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
PF449_RS16685 (PF449_16685) | 3481691..3482698 | - | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15609.84 Da Isoelectric Point: 10.3816
>T267192 WP_025467596.1 NZ_CP115623:c3477950-3477561 [Acinetobacter baumannii]
MINHLNFQLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLH
MINHLNFQLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLH
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|