Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 3477625..3478278 | Replicon | chromosome |
Accession | NZ_CP115621 | ||
Organism | Acinetobacter baumannii strain 2022CK-00480 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | PF364_RS16650 | Protein ID | WP_025467596.1 |
Coordinates | 3477625..3478014 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V5V966 |
Locus tag | PF364_RS16655 | Protein ID | WP_001288210.1 |
Coordinates | 3478021..3478278 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PF364_RS16635 (PF364_16635) | 3472743..3474938 | - | 2196 | WP_001158905.1 | TRAP transporter large permease subunit | - |
PF364_RS16640 (PF364_16640) | 3475126..3475692 | - | 567 | WP_000651536.1 | rhombosortase | - |
PF364_RS16645 (PF364_16645) | 3475770..3476855 | - | 1086 | WP_000049106.1 | hypothetical protein | - |
PF364_RS16650 (PF364_16650) | 3477625..3478014 | - | 390 | WP_025467596.1 | membrane protein | Toxin |
PF364_RS16655 (PF364_16655) | 3478021..3478278 | - | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
PF364_RS16660 (PF364_16660) | 3478466..3479638 | + | 1173 | WP_031961342.1 | acyl-CoA dehydrogenase family protein | - |
PF364_RS16665 (PF364_16665) | 3479687..3481177 | - | 1491 | WP_000415133.1 | NAD(P)/FAD-dependent oxidoreductase | - |
PF364_RS16670 (PF364_16670) | 3481359..3481736 | - | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
PF364_RS16675 (PF364_16675) | 3481755..3482762 | - | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15609.84 Da Isoelectric Point: 10.3816
>T267190 WP_025467596.1 NZ_CP115621:c3478014-3477625 [Acinetobacter baumannii]
MINHLNFQLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLH
MINHLNFQLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLH
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|