Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1244795..1245712 | Replicon | chromosome |
Accession | NZ_CP115604 | ||
Organism | Bacillus velezensis strain FJAT-54560 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | A0A6A8LGT8 |
Locus tag | PAN99_RS06545 | Protein ID | WP_003154806.1 |
Coordinates | 1244966..1245712 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | PAN99_RS06540 | Protein ID | WP_003154807.1 |
Coordinates | 1244795..1244965 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAN99_RS06505 (PAN99_06505) | 1240027..1241649 | + | 1623 | WP_003154821.1 | pyocin knob domain-containing protein | - |
PAN99_RS06510 (PAN99_06510) | 1241662..1242033 | + | 372 | WP_014304856.1 | XkdW family protein | - |
PAN99_RS06515 (PAN99_06515) | 1242039..1242236 | + | 198 | WP_044053582.1 | XkdX family protein | - |
PAN99_RS06520 (PAN99_06520) | 1242293..1243054 | + | 762 | WP_044053129.1 | hypothetical protein | - |
PAN99_RS06525 (PAN99_06525) | 1243106..1243369 | + | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
PAN99_RS06530 (PAN99_06530) | 1243383..1243646 | + | 264 | WP_003154813.1 | phage holin | - |
PAN99_RS06535 (PAN99_06535) | 1243660..1244538 | + | 879 | WP_024085195.1 | N-acetylmuramoyl-L-alanine amidase | - |
PAN99_RS06540 (PAN99_06540) | 1244795..1244965 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
PAN99_RS06545 (PAN99_06545) | 1244966..1245712 | - | 747 | WP_003154806.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
PAN99_RS06550 (PAN99_06550) | 1245816..1246814 | - | 999 | WP_003154805.1 | inorganic phosphate transporter | - |
PAN99_RS06555 (PAN99_06555) | 1246827..1247444 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
PAN99_RS06560 (PAN99_06560) | 1247730..1249046 | - | 1317 | WP_044053130.1 | amino acid permease | - |
PAN99_RS06565 (PAN99_06565) | 1249370..1250320 | + | 951 | WP_014304860.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29034.50 Da Isoelectric Point: 4.6947
>T267189 WP_003154806.1 NZ_CP115604:c1245712-1244966 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYGEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYGEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6A8LGT8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | I2HQ14 |