Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 477256..477893 | Replicon | chromosome |
Accession | NZ_CP115604 | ||
Organism | Bacillus velezensis strain FJAT-54560 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | PAN99_RS02480 | Protein ID | WP_003156187.1 |
Coordinates | 477543..477893 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | PAN99_RS02475 | Protein ID | WP_003156188.1 |
Coordinates | 477256..477537 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAN99_RS02455 (PAN99_02455) | 473621..474220 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
PAN99_RS02460 (PAN99_02460) | 474313..474678 | + | 366 | WP_060657770.1 | holo-ACP synthase | - |
PAN99_RS02465 (PAN99_02465) | 474843..475850 | + | 1008 | WP_003156191.1 | outer membrane lipoprotein carrier protein LolA | - |
PAN99_RS02470 (PAN99_02470) | 475967..477136 | + | 1170 | WP_025853726.1 | alanine racemase | - |
PAN99_RS02475 (PAN99_02475) | 477256..477537 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
PAN99_RS02480 (PAN99_02480) | 477543..477893 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
PAN99_RS02485 (PAN99_02485) | 478011..478832 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
PAN99_RS02490 (PAN99_02490) | 478837..479202 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
PAN99_RS02495 (PAN99_02495) | 479205..479606 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
PAN99_RS02500 (PAN99_02500) | 479618..480625 | + | 1008 | WP_003156177.1 | PP2C family protein-serine/threonine phosphatase | - |
PAN99_RS02505 (PAN99_02505) | 480689..481018 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
PAN99_RS02510 (PAN99_02510) | 481015..481497 | + | 483 | WP_003156173.1 | anti-sigma B factor RsbW | - |
PAN99_RS02515 (PAN99_02515) | 481463..482251 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
PAN99_RS02520 (PAN99_02520) | 482251..482853 | + | 603 | WP_003156170.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T267188 WP_003156187.1 NZ_CP115604:477543-477893 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|