Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-DinJ |
Location | 4380296..4380812 | Replicon | chromosome |
Accession | NZ_CP115551 | ||
Organism | Salmonella enterica subsp. enterica serovar Bispebjerg strain 20SAL-1342-3 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A3V5VNJ7 |
Locus tag | PEE20_RS21990 | Protein ID | WP_000220577.1 |
Coordinates | 4380296..4380580 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | PEE20_RS21995 | Protein ID | WP_152210448.1 |
Coordinates | 4380570..4380812 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PEE20_RS21975 (4375412) | 4375412..4377064 | + | 1653 | WP_270805234.1 | alpha,alpha-phosphotrehalase | - |
PEE20_RS21980 (4377473) | 4377473..4379611 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
PEE20_RS21985 (4379828) | 4379828..4380292 | + | 465 | WP_017465840.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
PEE20_RS21990 (4380296) | 4380296..4380580 | - | 285 | WP_000220577.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PEE20_RS21995 (4380570) | 4380570..4380812 | - | 243 | WP_152210448.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PEE20_RS22000 (4380890) | 4380890..4382803 | - | 1914 | WP_139762420.1 | BglG family transcription antiterminator | - |
PEE20_RS22005 (4382820) | 4382820..4383560 | - | 741 | WP_270805245.1 | KDGP aldolase family protein | - |
PEE20_RS22010 (4383557) | 4383557..4384675 | - | 1119 | WP_151115548.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
PEE20_RS22015 (4384659) | 4384659..4385792 | - | 1134 | WP_000459930.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10912.71 Da Isoelectric Point: 9.8739
>T267185 WP_000220577.1 NZ_CP115551:c4380580-4380296 [Salmonella enterica subsp. enterica serovar Bispebjerg]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|