Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 4310835..4311385 | Replicon | chromosome |
| Accession | NZ_CP115551 | ||
| Organism | Salmonella enterica subsp. enterica serovar Bispebjerg strain 20SAL-1342-3 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | M7RJ32 |
| Locus tag | PEE20_RS21645 | Protein ID | WP_001199743.1 |
| Coordinates | 4310835..4311143 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | M7RP97 |
| Locus tag | PEE20_RS21650 | Protein ID | WP_001118105.1 |
| Coordinates | 4311146..4311385 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PEE20_RS21625 (4305876) | 4305876..4306133 | + | 258 | WP_001054380.1 | YjhX family toxin | - |
| PEE20_RS21630 (4306138) | 4306138..4307769 | + | 1632 | WP_151115613.1 | class I SAM-dependent methyltransferase | - |
| PEE20_RS21635 (4308329) | 4308329..4309045 | + | 717 | WP_000532939.1 | YebC/PmpR family DNA-binding transcriptional regulator | - |
| PEE20_RS21640 (4309525) | 4309525..4310400 | - | 876 | WP_270805137.1 | HNH endonuclease | - |
| PEE20_RS21645 (4310835) | 4310835..4311143 | - | 309 | WP_001199743.1 | CcdB family protein | Toxin |
| PEE20_RS21650 (4311146) | 4311146..4311385 | - | 240 | WP_001118105.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| PEE20_RS21655 (4311494) | 4311494..4311742 | - | 249 | WP_023203347.1 | ribbon-helix-helix protein, CopG family | - |
| PEE20_RS21660 (4311807) | 4311807..4312640 | - | 834 | WP_270805142.1 | DUF4942 domain-containing protein | - |
| PEE20_RS21665 (4312756) | 4312756..4313100 | - | 345 | WP_260776419.1 | toxin | - |
| PEE20_RS21670 (4313115) | 4313115..4313444 | - | 330 | WP_001136058.1 | type IV toxin-antitoxin system YeeU family antitoxin | - |
| PEE20_RS21675 (4313507) | 4313507..4314007 | - | 501 | WP_270805144.1 | DNA repair protein RadC | - |
| PEE20_RS21680 (4314020) | 4314020..4314838 | - | 819 | WP_270805146.1 | DUF932 domain-containing protein | - |
| PEE20_RS21685 (4314980) | 4314980..4315438 | - | 459 | WP_000502121.1 | IS200/IS605-like element IS200F family transposase | - |
| PEE20_RS21690 (4315395) | 4315395..4315577 | - | 183 | WP_000431187.1 | hypothetical protein | - |
| PEE20_RS21695 (4315651) | 4315651..4315896 | - | 246 | WP_000082136.1 | DUF905 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4301681..4339192 | 37511 | |
| - | flank | IS/Tn | - | - | 4314980..4315438 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T267183 WP_001199743.1 NZ_CP115551:c4311143-4310835 [Salmonella enterica subsp. enterica serovar Bispebjerg]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H9SZK8 |