Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 4270759..4271335 | Replicon | chromosome |
| Accession | NZ_CP115551 | ||
| Organism | Salmonella enterica subsp. enterica serovar Bispebjerg strain 20SAL-1342-3 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | M7RG88 |
| Locus tag | PEE20_RS21475 | Protein ID | WP_001131963.1 |
| Coordinates | 4271048..4271335 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A6C6ZAR7 |
| Locus tag | PEE20_RS21470 | Protein ID | WP_000063143.1 |
| Coordinates | 4270759..4271061 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PEE20_RS21455 (4267269) | 4267269..4269419 | + | 2151 | WP_000379929.1 | pyruvate/proton symporter BtsT | - |
| PEE20_RS21460 (4269514) | 4269514..4269717 | + | 204 | WP_000460616.1 | YbdD/YjiX family protein | - |
| PEE20_RS21465 (4269728) | 4269728..4270684 | + | 957 | WP_000187838.1 | GTPase | - |
| PEE20_RS21470 (4270759) | 4270759..4271061 | - | 303 | WP_000063143.1 | BrnA antitoxin family protein | Antitoxin |
| PEE20_RS21475 (4271048) | 4271048..4271335 | - | 288 | WP_001131963.1 | BrnT family toxin | Toxin |
| PEE20_RS21480 (4271745) | 4271745..4273586 | + | 1842 | WP_020839636.1 | nuclease-related domain-containing DEAD/DEAH box helicase | - |
| PEE20_RS21485 (4274199) | 4274199..4274774 | + | 576 | WP_000593785.1 | restriction endonuclease subunit S | - |
| PEE20_RS21490 (4274767) | 4274767..4276032 | + | 1266 | WP_228412076.1 | N-6 DNA methylase | - |
| PEE20_RS21495 (4276064) | 4276064..4276198 | - | 135 | WP_001055726.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11294.80 Da Isoelectric Point: 9.5894
>T267182 WP_001131963.1 NZ_CP115551:c4271335-4271048 [Salmonella enterica subsp. enterica serovar Bispebjerg]
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11402.01 Da Isoelectric Point: 10.1293
>AT267182 WP_000063143.1 NZ_CP115551:c4271061-4270759 [Salmonella enterica subsp. enterica serovar Bispebjerg]
MSMVKHKRGNASALSAQHEAELKALVKKSDDEIDYSDIPASEDGQWSEAVRGKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLREQNKK
MSMVKHKRGNASALSAQHEAELKALVKKSDDEIDYSDIPASEDGQWSEAVRGKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLREQNKK
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|