Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3675112..3675732 | Replicon | chromosome |
Accession | NZ_CP115551 | ||
Organism | Salmonella enterica subsp. enterica serovar Bispebjerg strain 20SAL-1342-3 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PEE20_RS18700 | Protein ID | WP_001280991.1 |
Coordinates | 3675514..3675732 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PEE20_RS18695 | Protein ID | WP_000344807.1 |
Coordinates | 3675112..3675486 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PEE20_RS18685 (3670251) | 3670251..3671444 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PEE20_RS18690 (3671467) | 3671467..3674616 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
PEE20_RS18695 (3675112) | 3675112..3675486 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PEE20_RS18700 (3675514) | 3675514..3675732 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PEE20_RS18705 (3675911) | 3675911..3676462 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
PEE20_RS18710 (3676579) | 3676579..3677049 | + | 471 | WP_000136181.1 | YlaC family protein | - |
PEE20_RS18715 (3677105) | 3677105..3677245 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PEE20_RS18720 (3677251) | 3677251..3677511 | - | 261 | WP_079787602.1 | type B 50S ribosomal protein L31 | - |
PEE20_RS18725 (3677736) | 3677736..3679286 | + | 1551 | WP_270804766.1 | EAL domain-containing protein | - |
PEE20_RS18735 (3679517) | 3679517..3679906 | + | 390 | WP_000961285.1 | MGMT family protein | - |
PEE20_RS18740 (3679939) | 3679939..3680508 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T267181 WP_001280991.1 NZ_CP115551:3675514-3675732 [Salmonella enterica subsp. enterica serovar Bispebjerg]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT267181 WP_000344807.1 NZ_CP115551:3675112-3675486 [Salmonella enterica subsp. enterica serovar Bispebjerg]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|