267172

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 315626..316212 Replicon chromosome
Accession NZ_CP115551
Organism Salmonella enterica subsp. enterica serovar Bispebjerg strain 20SAL-1342-3

Toxin (Protein)


Gene name doc Uniprot ID Q57IR9
Locus tag PEE20_RS01450 Protein ID WP_000174963.1
Coordinates 315844..316212 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0R9PI96
Locus tag PEE20_RS01445 Protein ID WP_001535398.1
Coordinates 315626..315847 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PEE20_RS01420 (310646) 310646..311755 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
PEE20_RS01425 (311815) 311815..312741 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PEE20_RS01430 (312738) 312738..314015 + 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
PEE20_RS01435 (314012) 314012..314779 + 768 WP_000082080.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
PEE20_RS01440 (314781) 314781..315494 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
PEE20_RS01445 (315626) 315626..315847 + 222 WP_001535398.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PEE20_RS01450 (315844) 315844..316212 + 369 WP_000174963.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PEE20_RS01455 (316471) 316471..317787 + 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
PEE20_RS01460 (317892) 317892..318779 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
PEE20_RS01465 (318776) 318776..319621 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
PEE20_RS01470 (319623) 319623..320693 + 1071 WP_000907846.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 305405..321430 16025


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13573.85 Da        Isoelectric Point: 6.7252

>T267172 WP_000174963.1 NZ_CP115551:315844-316212 [Salmonella enterica subsp. enterica serovar Bispebjerg]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8165.23 Da        Isoelectric Point: 6.4643

>AT267172 WP_001535398.1 NZ_CP115551:315626-315847 [Salmonella enterica subsp. enterica serovar Bispebjerg]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRKLADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5H6KCD5

Antitoxin

Source ID Structure
AlphaFold DB A0A0R9PI96

References