Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 4098169..4098804 | Replicon | chromosome |
| Accession | NZ_CP115484 | ||
| Organism | Paenibacillus sp. SYP-B4298 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A934MKW6 |
| Locus tag | PDL12_RS17145 | Protein ID | WP_020618872.1 |
| Coordinates | 4098169..4098519 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | PDL12_RS17150 | Protein ID | WP_028563293.1 |
| Coordinates | 4098523..4098804 (-) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PDL12_RS17130 | 4094260..4094766 | + | 507 | WP_270165652.1 | hypothetical protein | - |
| PDL12_RS17135 | 4095013..4096323 | + | 1311 | WP_270165654.1 | ParB/RepB/Spo0J family partition protein | - |
| PDL12_RS17140 | 4096355..4097896 | + | 1542 | WP_270165656.1 | DUF4901 domain-containing protein | - |
| PDL12_RS17145 | 4098169..4098519 | - | 351 | WP_020618872.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PDL12_RS17150 | 4098523..4098804 | - | 282 | WP_028563293.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| PDL12_RS17155 | 4099186..4100367 | - | 1182 | WP_270172629.1 | alanine racemase | - |
| PDL12_RS17160 | 4100523..4101713 | - | 1191 | WP_270165660.1 | outer membrane lipoprotein carrier protein LolA | - |
| PDL12_RS17165 | 4102021..4102668 | - | 648 | WP_270165662.1 | ATP-binding cassette domain-containing protein | - |
| PDL12_RS17170 | 4102665..4103423 | - | 759 | WP_270165664.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12892.81 Da Isoelectric Point: 4.8728
>T267170 WP_020618872.1 NZ_CP115484:c4098519-4098169 [Paenibacillus sp. SYP-B4298]
MIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAATHEFDRDSVILLEQI
RTIDKQRLTDKITHLDDETMRKVDEALQISVGLIDF
MIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAATHEFDRDSVILLEQI
RTIDKQRLTDKITHLDDETMRKVDEALQISVGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|