Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-Phd |
Location | 2552333..2553000 | Replicon | chromosome |
Accession | NZ_CP115465 | ||
Organism | Brevundimonas sp. NIBR11 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | O5O43_RS12870 | Protein ID | WP_271084292.1 |
Coordinates | 2552584..2553000 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | O5O43_RS12865 | Protein ID | WP_271084291.1 |
Coordinates | 2552333..2552584 (+) | Length | 84 a.a. |
Genomic Context
Location: 2548773..2549207 (435 bp)
Type: Others
Protein ID: WP_271084289.1
Type: Others
Protein ID: WP_271084289.1
Location: 2552333..2552584 (252 bp)
Type: Antitoxin
Protein ID: WP_271084291.1
Type: Antitoxin
Protein ID: WP_271084291.1
Location: 2552584..2553000 (417 bp)
Type: Toxin
Protein ID: WP_271084292.1
Type: Toxin
Protein ID: WP_271084292.1
Location: 2552997..2555489 (2493 bp)
Type: Others
Protein ID: WP_271084293.1
Type: Others
Protein ID: WP_271084293.1
Location: 2555486..2556229 (744 bp)
Type: Others
Protein ID: WP_271084294.1
Type: Others
Protein ID: WP_271084294.1
Location: 2547480..2548529 (1050 bp)
Type: Others
Protein ID: WP_271084288.1
Type: Others
Protein ID: WP_271084288.1
Location: 2549332..2552235 (2904 bp)
Type: Others
Protein ID: WP_271084290.1
Type: Others
Protein ID: WP_271084290.1
Location: 2556226..2556642 (417 bp)
Type: Others
Protein ID: WP_271084295.1
Type: Others
Protein ID: WP_271084295.1
Location: 2556642..2557457 (816 bp)
Type: Others
Protein ID: WP_271084296.1
Type: Others
Protein ID: WP_271084296.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O5O43_RS12850 (KKHFBJBL_02556) | 2547480..2548529 | - | 1050 | WP_271084288.1 | DUF2125 domain-containing protein | - |
O5O43_RS12855 (KKHFBJBL_02557) | 2548773..2549207 | + | 435 | WP_271084289.1 | VOC family protein | - |
O5O43_RS12860 (KKHFBJBL_02558) | 2549332..2552235 | - | 2904 | WP_271084290.1 | ATP-dependent DNA helicase | - |
O5O43_RS12865 (KKHFBJBL_02559) | 2552333..2552584 | + | 252 | WP_271084291.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
O5O43_RS12870 (KKHFBJBL_02560) | 2552584..2553000 | + | 417 | WP_271084292.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
O5O43_RS12875 (KKHFBJBL_02561) | 2552997..2555489 | + | 2493 | WP_271084293.1 | ligase-associated DNA damage response DEXH box helicase | - |
O5O43_RS12880 (KKHFBJBL_02562) | 2555486..2556229 | + | 744 | WP_271084294.1 | ligase-associated DNA damage response endonuclease PdeM | - |
O5O43_RS12885 (KKHFBJBL_02563) | 2556226..2556642 | - | 417 | WP_271084295.1 | DUF3429 domain-containing protein | - |
O5O43_RS12890 (KKHFBJBL_02564) | 2556642..2557457 | - | 816 | WP_271084296.1 | TIGR02186 family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15727.91 Da Isoelectric Point: 5.0132
>T267168 WP_271084292.1 NZ_CP115465:2552584-2553000 [Brevundimonas sp. NIBR11]
MFLLDTNAISEPKRARPDPGVVAWLGEQLLSDLHLSVITVGELRRGIVRLEPSRRRDDLDFWLEDMILRYDERILPVDLD
VTERWASIAEAQRAAGRVSEMTDELIAATAHVHGLTVVTRNVRHFENTGCRVLSPWSE
MFLLDTNAISEPKRARPDPGVVAWLGEQLLSDLHLSVITVGELRRGIVRLEPSRRRDDLDFWLEDMILRYDERILPVDLD
VTERWASIAEAQRAAGRVSEMTDELIAATAHVHGLTVVTRNVRHFENTGCRVLSPWSE
Download Length: 417 bp