Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 3864063..3864687 | Replicon | chromosome |
| Accession | NZ_CP115464 | ||
| Organism | Brevundimonas sp. NIBR10 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | O5K39_RS18810 | Protein ID | WP_271145125.1 |
| Coordinates | 3864063..3864389 (+) | Length | 109 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | O5K39_RS18815 | Protein ID | WP_271145126.1 |
| Coordinates | 3864379..3864687 (+) | Length | 103 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O5K39_RS18795 (KOAAANKH_03738) | 3861765..3862223 | - | 459 | WP_271145122.1 | TIGR02300 family protein | - |
| O5K39_RS18800 (KOAAANKH_03739) | 3862353..3863675 | + | 1323 | WP_271145123.1 | 3-phosphoshikimate 1-carboxyvinyltransferase | - |
| O5K39_RS18805 (KOAAANKH_03740) | 3863672..3864058 | + | 387 | WP_271145124.1 | RidA family protein | - |
| O5K39_RS18810 (KOAAANKH_03741) | 3864063..3864389 | + | 327 | WP_271145125.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| O5K39_RS18815 (KOAAANKH_03742) | 3864379..3864687 | + | 309 | WP_271145126.1 | putative addiction module antidote protein | Antitoxin |
| O5K39_RS18820 (KOAAANKH_03743) | 3864687..3865331 | + | 645 | WP_271145127.1 | (d)CMP kinase | - |
| O5K39_RS18825 (KOAAANKH_03744) | 3865499..3867202 | + | 1704 | WP_271145128.1 | 30S ribosomal protein S1 | - |
| O5K39_RS18830 (KOAAANKH_03745) | 3867480..3867770 | + | 291 | WP_271145129.1 | integration host factor subunit beta | - |
| O5K39_RS18835 (KOAAANKH_03746) | 3867856..3868275 | + | 420 | WP_271145130.1 | large-conductance mechanosensitive channel protein MscL | - |
| O5K39_RS18840 (KOAAANKH_03747) | 3868266..3869399 | - | 1134 | WP_271145131.1 | N-acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 11875.54 Da Isoelectric Point: 10.1482
>T267167 WP_271145125.1 NZ_CP115464:3864063-3864389 [Brevundimonas sp. NIBR10]
MSPIDDNRSINVELSPRFVAWRDGLRDRLAVAKIASRILGLKRGHWGDVKPVGGGVSELRIHSGPGYRIYLTRRGADWIV
LLCGGDKDSQARDIAAAKSMASEFRDAD
MSPIDDNRSINVELSPRFVAWRDGLRDRLAVAKIASRILGLKRGHWGDVKPVGGGVSELRIHSGPGYRIYLTRRGADWIV
LLCGGDKDSQARDIAAAKSMASEFRDAD
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|