Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 3469418..3470010 Replicon chromosome
Accession NZ_CP115464
Organism Brevundimonas sp. NIBR10

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag O5K39_RS16905 Protein ID WP_271144765.1
Coordinates 3469418..3469795 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag O5K39_RS16910 Protein ID WP_271144766.1
Coordinates 3469792..3470010 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O5K39_RS16875 (KOAAANKH_03359) 3465535..3466065 + 531 WP_271144759.1 hypothetical protein -
O5K39_RS16880 (KOAAANKH_03360) 3466065..3466466 + 402 WP_271144760.1 TIGR01244 family sulfur transferase -
O5K39_RS16885 3466463..3466609 - 147 WP_271144761.1 hypothetical protein -
O5K39_RS16890 (KOAAANKH_03361) 3466679..3467581 + 903 WP_271144762.1 MBL fold metallo-hydrolase -
O5K39_RS16895 (KOAAANKH_03362) 3467566..3468228 - 663 WP_271144763.1 hypothetical protein -
O5K39_RS16900 (KOAAANKH_03363) 3468326..3469411 - 1086 WP_271144764.1 chorismate synthase -
O5K39_RS16905 (KOAAANKH_03364) 3469418..3469795 - 378 WP_271144765.1 VapC toxin family PIN domain ribonuclease Toxin
O5K39_RS16910 (KOAAANKH_03365) 3469792..3470010 - 219 WP_271144766.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
O5K39_RS16915 (KOAAANKH_03366) 3470072..3470785 - 714 WP_271144767.1 DnaJ C-terminal domain-containing protein -
O5K39_RS16920 (KOAAANKH_03367) 3470879..3471553 + 675 WP_271144768.1 pyridoxamine 5'-phosphate oxidase -
O5K39_RS16925 (KOAAANKH_03368) 3471566..3472744 - 1179 WP_271144769.1 glycosyltransferase family 61 protein -
O5K39_RS16930 (KOAAANKH_03369) 3472807..3473607 + 801 WP_271144770.1 class I SAM-dependent methyltransferase -
O5K39_RS16935 (KOAAANKH_03370) 3473611..3474813 + 1203 WP_271144771.1 dTDP-4-amino-4,6-dideoxygalactose transaminase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Bacterial antitoxin of type II TA system, VapB

(2-46)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14258.38 Da        Isoelectric Point: 7.2516

>T267166 WP_271144765.1 NZ_CP115464:c3469795-3469418 [Brevundimonas sp. NIBR10]
VILVLADTSVWTDHIRHGDPQMEALTDRERLLMHPYVIAELRMGNLKRRKAFLSSLHQMDMATRASDEEVSTLVESHHLF
GSGIGWIDAHLLTSVLLMGEARLWTRDRRLNSAAQRLGVAFQPHH

Download         Length: 378 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 7981.81 Da        Isoelectric Point: 4.4633

>AT267166 WP_271144766.1 NZ_CP115464:c3470010-3469792 [Brevundimonas sp. NIBR10]
VRTTLNLDDELMEAAAEYSGQVEKSAIVRTALQAYVAREAARRLARLGGSQPDFEPGPRKRYWGVEEGGDEE

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References