Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 3238316..3238962 | Replicon | chromosome |
| Accession | NZ_CP115464 | ||
| Organism | Brevundimonas sp. NIBR10 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | O5K39_RS15880 | Protein ID | WP_271144574.1 |
| Coordinates | 3238316..3238705 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | O5K39_RS15885 | Protein ID | WP_271144575.1 |
| Coordinates | 3238702..3238962 (-) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O5K39_RS15865 (KOAAANKH_03155) | 3233464..3234450 | - | 987 | WP_271144571.1 | M20/M25/M40 family metallo-hydrolase | - |
| O5K39_RS15870 (KOAAANKH_03156) | 3234570..3236885 | + | 2316 | WP_271144572.1 | NAD-dependent DNA ligase LigA | - |
| O5K39_RS15875 (KOAAANKH_03157) | 3237264..3238253 | - | 990 | WP_271144573.1 | aldo/keto reductase | - |
| O5K39_RS15880 (KOAAANKH_03158) | 3238316..3238705 | - | 390 | WP_271144574.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| O5K39_RS15885 (KOAAANKH_03159) | 3238702..3238962 | - | 261 | WP_271144575.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| O5K39_RS15890 (KOAAANKH_03160) | 3238997..3240826 | - | 1830 | WP_271144576.1 | aminopeptidase P family protein | - |
| O5K39_RS15895 (KOAAANKH_03161) | 3240889..3241791 | - | 903 | WP_271144577.1 | enoyl-CoA hydratase-related protein | - |
| O5K39_RS15900 (KOAAANKH_03162) | 3241871..3242308 | + | 438 | WP_271144578.1 | HIT family protein | - |
| O5K39_RS15905 (KOAAANKH_03163) | 3242305..3242658 | - | 354 | WP_271144579.1 | DMT family protein | - |
| O5K39_RS15915 (KOAAANKH_03165) | 3242916..3243548 | + | 633 | WP_271144580.1 | TetR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14380.43 Da Isoelectric Point: 4.7687
>T267165 WP_271144574.1 NZ_CP115464:c3238705-3238316 [Brevundimonas sp. NIBR10]
MIVDTSALVAIINSEPEAERFLSILIREPRVRLSAVTYFEFGMVVDNWRDEPTSLKVDRLLSGVEAEIVEVDADTARLAR
AAYRRFGKKNHPAKLNFGDCFAYALAKQTGEPLLFKGDDFAQTDIVSAV
MIVDTSALVAIINSEPEAERFLSILIREPRVRLSAVTYFEFGMVVDNWRDEPTSLKVDRLLSGVEAEIVEVDADTARLAR
AAYRRFGKKNHPAKLNFGDCFAYALAKQTGEPLLFKGDDFAQTDIVSAV
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|