Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/CC2985(antitoxin) |
| Location | 155169..155724 | Replicon | chromosome |
| Accession | NZ_CP115464 | ||
| Organism | Brevundimonas sp. NIBR10 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | O5K39_RS00810 | Protein ID | WP_271145413.1 |
| Coordinates | 155431..155724 (+) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | O5K39_RS00805 | Protein ID | WP_271145412.1 |
| Coordinates | 155169..155414 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O5K39_RS00790 (KOAAANKH_00160) | 151127..152956 | + | 1830 | WP_271145409.1 | cation:proton antiporter | - |
| O5K39_RS00795 (KOAAANKH_00161) | 153245..153901 | + | 657 | WP_271145410.1 | TetR/AcrR family transcriptional regulator | - |
| O5K39_RS00800 (KOAAANKH_00162) | 153968..155086 | - | 1119 | WP_271145411.1 | aromatic ring-hydroxylating dioxygenase subunit alpha | - |
| O5K39_RS00805 (KOAAANKH_00163) | 155169..155414 | + | 246 | WP_271145412.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| O5K39_RS00810 | 155431..155724 | + | 294 | WP_271145413.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| O5K39_RS00815 (KOAAANKH_00164) | 155721..156470 | + | 750 | WP_271145414.1 | DUF72 domain-containing protein | - |
| O5K39_RS00820 (KOAAANKH_00165) | 156554..157624 | + | 1071 | WP_271145415.1 | NAD(P)-dependent alcohol dehydrogenase | - |
| O5K39_RS00825 (KOAAANKH_00166) | 157658..158287 | - | 630 | WP_271145416.1 | maleylacetoacetate isomerase | - |
| O5K39_RS00830 (KOAAANKH_00167) | 158290..158982 | - | 693 | WP_271145417.1 | fumarylacetoacetate hydrolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11080.59 Da Isoelectric Point: 5.0911
>T267163 WP_271145413.1 NZ_CP115464:155431-155724 [Brevundimonas sp. NIBR10]
MSLAARQDLSTIYRHGVEAFGQRQADRYIDGLLETLDLIADFPEMARVRDSLNPPACVHGHRRHVIVYDLLADEIVLIVR
IRHALEDWQGLSGDMEQ
MSLAARQDLSTIYRHGVEAFGQRQADRYIDGLLETLDLIADFPEMARVRDSLNPPACVHGHRRHVIVYDLLADEIVLIVR
IRHALEDWQGLSGDMEQ
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|