Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/CC2985(antitoxin) |
| Location | 3418674..3419223 | Replicon | chromosome |
| Accession | NZ_CP115463 | ||
| Organism | Caulobacter sp. NIBR1757 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | O5I81_RS16585 | Protein ID | WP_271065971.1 |
| Coordinates | 3418912..3419223 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | O5I81_RS16580 | Protein ID | WP_271065970.1 |
| Coordinates | 3418674..3418922 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O5I81_RS16560 (AMEJIAPC_03287) | 3414502..3417027 | + | 2526 | WP_271065966.1 | helicase-related protein | - |
| O5I81_RS16565 (AMEJIAPC_03288) | 3417024..3417314 | + | 291 | WP_271065967.1 | RNA-binding S4 domain-containing protein | - |
| O5I81_RS16570 (AMEJIAPC_03289) | 3417427..3417768 | + | 342 | WP_271065968.1 | ferredoxin family protein | - |
| O5I81_RS16575 (AMEJIAPC_03290) | 3418049..3418552 | + | 504 | WP_271065969.1 | CarD family transcriptional regulator | - |
| O5I81_RS16580 (AMEJIAPC_03291) | 3418674..3418922 | + | 249 | WP_271065970.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| O5I81_RS16585 (AMEJIAPC_03292) | 3418912..3419223 | + | 312 | WP_271065971.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| O5I81_RS16590 (AMEJIAPC_03293) | 3419286..3420155 | + | 870 | WP_271065972.1 | RNA polymerase factor sigma-32 | - |
| O5I81_RS16595 (AMEJIAPC_03294) | 3420149..3420892 | - | 744 | WP_271065973.1 | thermonuclease family protein | - |
| O5I81_RS16600 (AMEJIAPC_03295) | 3420889..3422196 | - | 1308 | WP_271065974.1 | C4-dicarboxylate transporter DctA | - |
| O5I81_RS16605 (AMEJIAPC_03296) | 3422502..3422891 | - | 390 | WP_271065975.1 | response regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11587.96 Da Isoelectric Point: 6.0680
>T267161 WP_271065971.1 NZ_CP115463:3418912-3419223 [Caulobacter sp. NIBR1757]
MKARLSVRAQQDLIDIYATGVRLFGVAQADRYQDGFEAAFDFIADYPLASRERAGAFRSARIHPYKSHVIVYLLDSDGVL
IVRIRHGHEDWANDPAGPDDLNN
MKARLSVRAQQDLIDIYATGVRLFGVAQADRYQDGFEAAFDFIADYPLASRERAGAFRSARIHPYKSHVIVYLLDSDGVL
IVRIRHGHEDWANDPAGPDDLNN
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|