Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 3173548..3174113 Replicon chromosome
Accession NZ_CP115463
Organism Caulobacter sp. NIBR1757

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag O5I81_RS15455 Protein ID WP_271065753.1
Coordinates 3173548..3173919 (-) Length 124 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag O5I81_RS15460 Protein ID WP_271065754.1
Coordinates 3173916..3174113 (-) Length 66 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O5I81_RS15420 (AMEJIAPC_03062) 3169163..3170428 - 1266 WP_271065746.1 pentapeptide repeat-containing protein -
O5I81_RS15425 (AMEJIAPC_03063) 3170485..3170925 - 441 WP_271065747.1 bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD -
O5I81_RS15430 (AMEJIAPC_03064) 3170925..3171635 - 711 WP_271065748.1 2,3-diphosphoglycerate-dependent phosphoglycerate mutase -
O5I81_RS15435 (AMEJIAPC_03065) 3171726..3171977 + 252 WP_271065749.1 type II toxin-antitoxin system prevent-host-death family antitoxin -
O5I81_RS15440 3171981..3172388 + 408 WP_271065750.1 type II toxin-antitoxin system VapC family toxin -
O5I81_RS15445 (AMEJIAPC_03067) 3172430..3172591 + 162 WP_271065751.1 hypothetical protein -
O5I81_RS15450 (AMEJIAPC_03068) 3172588..3173544 + 957 WP_271065752.1 KpsF/GutQ family sugar-phosphate isomerase -
O5I81_RS15455 (AMEJIAPC_03069) 3173548..3173919 - 372 WP_271065753.1 type II toxin-antitoxin system VapC family toxin Toxin
O5I81_RS15460 (AMEJIAPC_03070) 3173916..3174113 - 198 WP_271065754.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
O5I81_RS15465 (AMEJIAPC_03071) 3174242..3175744 + 1503 WP_271065755.1 phosphomannomutase/phosphoglucomutase -
O5I81_RS15470 (AMEJIAPC_03072) 3175934..3177238 + 1305 WP_271065756.1 UDP-glucose/GDP-mannose dehydrogenase family protein -
O5I81_RS15475 (AMEJIAPC_03073) 3177604..3178866 + 1263 WP_271065757.1 MFS transporter -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-46)


Sequences

Toxin        


Download         Length: 124 a.a.        Molecular weight: 13130.11 Da        Isoelectric Point: 6.8703

>T267160 WP_271065753.1 NZ_CP115463:c3173919-3173548 [Caulobacter sp. NIBR1757]
MILLDTSVWVGHLRNGDAGVESLLNSGQVLCHSVVIGELALGNLANRARLLGLLKALPAAVEASHAEVMALVERRRLWGL
GIGYGDAQLLAATHLTPDARLWTRDRRLGEVARDQGIAAFSDG

Download         Length: 372 bp

Antitoxin


Download         Length: 66 a.a.        Molecular weight: 7111.19 Da        Isoelectric Point: 9.1060

>AT267160 WP_271065754.1 NZ_CP115463:c3174113-3173916 [Caulobacter sp. NIBR1757]
MRTTVALDDDLMARAREMSGLKDAAPLLRAALTALIERESARRLARLGGSEPELEAPPRRRPAAE

Download         Length: 198 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References