Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/DUF433(antitoxin)
Location 1709148..1709695 Replicon chromosome
Accession NZ_CP115463
Organism Caulobacter sp. NIBR1757

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag O5I81_RS08260 Protein ID WP_271068470.1
Coordinates 1709369..1709695 (+) Length 109 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag O5I81_RS08255 Protein ID WP_271068469.1
Coordinates 1709148..1709372 (+) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O5I81_RS08210 (AMEJIAPC_01636) 1704244..1704726 + 483 WP_271068460.1 hypothetical protein -
O5I81_RS08215 (AMEJIAPC_01637) 1704830..1705516 + 687 WP_271068461.1 NADH-quinone oxidoreductase subunit NuoE -
O5I81_RS08220 (AMEJIAPC_01638) 1705522..1705800 + 279 WP_271068462.1 hypothetical protein -
O5I81_RS08225 (AMEJIAPC_01639) 1705873..1707192 + 1320 WP_271068463.1 NADH-quinone oxidoreductase subunit NuoF -
O5I81_RS08230 (AMEJIAPC_01640) 1707203..1707493 + 291 WP_271068464.1 hypothetical protein -
O5I81_RS08235 (AMEJIAPC_01641) 1707490..1707849 + 360 WP_271068465.1 hypothetical protein -
O5I81_RS08240 (AMEJIAPC_01642) 1707852..1708247 + 396 WP_271068466.1 hypothetical protein -
O5I81_RS08245 (AMEJIAPC_01643) 1708250..1708570 + 321 WP_271068467.1 hypothetical protein -
O5I81_RS08250 (AMEJIAPC_01644) 1708650..1709105 + 456 WP_271068468.1 TM2 domain-containing protein -
O5I81_RS08255 (AMEJIAPC_01645) 1709148..1709372 + 225 WP_271068469.1 DUF433 domain-containing protein Antitoxin
O5I81_RS08260 1709369..1709695 + 327 WP_271068470.1 DUF5615 family PIN-like protein Toxin
O5I81_RS08265 (AMEJIAPC_01646) 1709799..1711859 + 2061 WP_271068471.1 NADH-quinone oxidoreductase subunit NuoG -
O5I81_RS08270 (AMEJIAPC_01647) 1711863..1712939 + 1077 WP_271068472.1 NADH-quinone oxidoreductase subunit NuoH -
O5I81_RS08275 (AMEJIAPC_01648) 1712939..1713175 + 237 WP_271068473.1 hypothetical protein -
O5I81_RS08280 (AMEJIAPC_01649) 1713172..1713660 + 489 WP_271068474.1 NADH-quinone oxidoreductase subunit NuoI -
O5I81_RS08285 (AMEJIAPC_01650) 1713721..1714338 + 618 WP_271069009.1 NADH-quinone oxidoreductase subunit J -
O5I81_RS08290 (AMEJIAPC_01651) 1714335..1714640 + 306 WP_271068475.1 NADH-quinone oxidoreductase subunit NuoK -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Domain of unknown function DUF5615

(2-76)

Antitoxin

Protein of unknown function DUF433

(7-62)


Sequences

Toxin        


Download         Length: 109 a.a.        Molecular weight: 12130.92 Da        Isoelectric Point: 5.1603

>T267159 WP_271068470.1 NZ_CP115463:1709369-1709695 [Caulobacter sp. NIBR1757]
VKFFVDEQLPIGLARWLRWKGHDAEHIDELGLRASPDVAIGHLVADASGVVITKDSDFIELRRRRPDFQILWLRTGNIAT
PQLLARLEEVWPEVIGGLSAGDPVVEVR

Download         Length: 327 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8165.45 Da        Isoelectric Point: 4.7513

>AT267159 WP_271068469.1 NZ_CP115463:1709148-1709372 [Caulobacter sp. NIBR1757]
MYIADRITVESGKMGGRPCVRGLRITVKDVLEILASGMTKEEILADYPALEPEDFPAVLRYAAGEFNHRIVAAE

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References