Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-yefM/Txe-RelB
Location 1900264..1900793 Replicon chromosome
Accession NZ_CP115461
Organism Coxiella burnetii strain RMSFV

Toxin (Protein)


Gene name relE Uniprot ID Q83AB3
Locus tag PDI63_RS10650 Protein ID WP_005769718.1
Coordinates 1900518..1900793 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID Q83AB4
Locus tag PDI63_RS10645 Protein ID WP_005769716.1
Coordinates 1900264..1900518 (+) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PDI63_RS10600 1895332..1895706 + 375 WP_005769706.1 hypothetical protein -
PDI63_RS10605 1895751..1896449 + 699 WP_010958581.1 outer membrane beta-barrel protein -
PDI63_RS10610 1896513..1897454 + 942 WP_005769709.1 S49 family peptidase -
PDI63_RS10615 1897467..1898342 + 876 WP_010958582.1 symmetrical bis(5'-nucleosyl)-tetraphosphatase -
PDI63_RS10620 1898318..1898422 + 105 WP_230578142.1 type II toxin-antitoxin system YoeB family toxin -
PDI63_RS10625 1898491..1898625 + 135 WP_010958583.1 hypothetical protein -
PDI63_RS10630 1898786..1899805 + 1020 WP_041952483.1 IS110-like element IS1111A family transposase -
PDI63_RS10635 1899802..1900074 - 273 WP_010957319.1 hypothetical protein -
PDI63_RS10640 1900075..1900203 + 129 WP_230578144.1 hypothetical protein -
PDI63_RS10645 1900264..1900518 + 255 WP_005769716.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
PDI63_RS10650 1900518..1900793 + 276 WP_005769718.1 Txe/YoeB family addiction module toxin Toxin
PDI63_RS10655 1900766..1901251 - 486 WP_005769725.1 dihydrofolate reductase -
PDI63_RS10660 1901248..1902051 - 804 WP_010958584.1 epoxyqueuosine reductase QueH -
PDI63_RS10665 1902247..1902534 + 288 WP_010958585.1 acylphosphatase -
PDI63_RS10670 1902510..1903064 - 555 WP_005769732.1 D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase -
PDI63_RS10675 1903077..1904021 - 945 WP_010958586.1 methionyl-tRNA formyltransferase -
PDI63_RS10680 1904209..1905135 + 927 WP_010958587.1 DNA-processing protein DprA -
PDI63_RS10685 1905132..1905611 + 480 WP_010958588.1 DUF494 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 1898786..1899805 1019


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(5-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 11150.86 Da        Isoelectric Point: 9.6762

>T267158 WP_005769718.1 NZ_CP115461:1900518-1900793 [Coxiella burnetii]
MQISFTPEAWEDYLYWQKFDKKMLRRINELIKDAMHEPFSGKGKPEPLKFELQGYWSRRLDQEHRLVYKVLDDSLMIIAA
RFHYNRLNSKN

Download         Length: 276 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9624.25 Da        Isoelectric Point: 10.4802

>AT267158 WP_005769716.1 NZ_CP115461:1900264-1900518 [Coxiella burnetii]
MNVVTFSELRAQLKKILDLSADQHEPVVVKRPNKETMVILSLRDFEALKETAYLLSNEANAARLRQSIRSLKQGKAQKKK
LMED

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q83AB3

Antitoxin

Source ID Structure
AlphaFold DB Q83AB4

References