Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
Location | 531828..532387 | Replicon | plasmid pKN1 |
Accession | NZ_CP115457 | ||
Organism | Sphingobium yanoikuyae strain CC4533 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | PAE53_RS24885 | Protein ID | WP_270093862.1 |
Coordinates | 532094..532387 (+) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | PAE53_RS24880 | Protein ID | WP_214867854.1 |
Coordinates | 531828..532106 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAE53_RS24860 (PAE53_24860) | 527390..528931 | + | 1542 | WP_270093858.1 | peptidase S10 | - |
PAE53_RS24865 (PAE53_24865) | 528931..530457 | + | 1527 | WP_270093859.1 | peptidase S10 | - |
PAE53_RS24870 (PAE53_24870) | 530656..531246 | - | 591 | WP_270093860.1 | nucleotidyltransferase family protein | - |
PAE53_RS24875 (PAE53_24875) | 531272..531595 | - | 324 | WP_270093861.1 | hypothetical protein | - |
PAE53_RS24880 (PAE53_24880) | 531828..532106 | + | 279 | WP_214867854.1 | CopG family ribbon-helix-helix protein | Antitoxin |
PAE53_RS24885 (PAE53_24885) | 532094..532387 | + | 294 | WP_270093862.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PAE53_RS24890 (PAE53_24890) | 532497..532780 | + | 284 | Protein_483 | hypothetical protein | - |
PAE53_RS24895 (PAE53_24895) | 532811..533020 | - | 210 | WP_270094157.1 | hypothetical protein | - |
PAE53_RS24900 (PAE53_24900) | 533423..533755 | - | 333 | WP_270093863.1 | hypothetical protein | - |
PAE53_RS24905 (PAE53_24905) | 534110..534298 | - | 189 | WP_270093864.1 | hypothetical protein | - |
PAE53_RS24910 (PAE53_24910) | 534669..534935 | + | 267 | WP_270093865.1 | hypothetical protein | - |
PAE53_RS24915 (PAE53_24915) | 534969..535211 | + | 243 | WP_270093866.1 | hypothetical protein | - |
PAE53_RS24920 (PAE53_24920) | 535443..535649 | - | 207 | WP_270093867.1 | hypothetical protein | - |
PAE53_RS24925 (PAE53_24925) | 535708..535932 | + | 225 | WP_270093868.1 | hypothetical protein | - |
PAE53_RS24930 (PAE53_24930) | 535929..536366 | + | 438 | WP_270093869.1 | PIN domain-containing protein | - |
PAE53_RS24935 (PAE53_24935) | 536366..537284 | + | 919 | Protein_492 | HEPN domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..647509 | 647509 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10750.33 Da Isoelectric Point: 8.4278
>T267155 WP_270093862.1 NZ_CP115457:532094-532387 [Sphingobium yanoikuyae]
VSRLIWTPNALADVQRLYGWLLPKDAEAATRAVATIRAGVRILAASPRIGRPVEDMDPDYREKLIDFGNSGYVALYRLDG
ETVAILAVRHQKEAGYP
VSRLIWTPNALADVQRLYGWLLPKDAEAATRAVATIRAGVRILAASPRIGRPVEDMDPDYREKLIDFGNSGYVALYRLDG
ETVAILAVRHQKEAGYP
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|