Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacT-ataR/DUF1778(antitoxin) |
Location | 1118102..1118938 | Replicon | chromosome |
Accession | NZ_CP115456 | ||
Organism | Sphingobium yanoikuyae strain CC4533 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | PAE53_RS05445 | Protein ID | WP_270092854.1 |
Coordinates | 1118423..1118938 (+) | Length | 172 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | - |
Locus tag | PAE53_RS05440 | Protein ID | WP_066769168.1 |
Coordinates | 1118102..1118401 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAE53_RS05425 (PAE53_05425) | 1115092..1116513 | - | 1422 | WP_270092851.1 | conjugal transfer protein TraH | - |
PAE53_RS05430 (PAE53_05430) | 1116567..1117142 | - | 576 | WP_270092852.1 | hypothetical protein | - |
PAE53_RS05435 (PAE53_05435) | 1117142..1117996 | - | 855 | WP_270092853.1 | conjugal transfer protein TraF | - |
PAE53_RS05440 (PAE53_05440) | 1118102..1118401 | + | 300 | WP_066769168.1 | DUF1778 domain-containing protein | Antitoxin |
PAE53_RS05445 (PAE53_05445) | 1118423..1118938 | + | 516 | WP_270092854.1 | GNAT family N-acetyltransferase | Toxin |
PAE53_RS05450 (PAE53_05450) | 1118962..1119567 | - | 606 | WP_066769172.1 | S26 family signal peptidase | - |
PAE53_RS05455 (PAE53_05455) | 1119539..1120420 | - | 882 | WP_270092855.1 | TrbC family F-type conjugative pilus assembly protein | - |
PAE53_RS05460 (PAE53_05460) | 1120392..1121516 | - | 1125 | WP_270093638.1 | conjugal transfer protein TraN | - |
PAE53_RS05465 (PAE53_05465) | 1121513..1123369 | - | 1857 | WP_270093639.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 1077635..1212390 | 134755 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 172 a.a. Molecular weight: 18407.13 Da Isoelectric Point: 7.0403
>T267152 WP_270092854.1 NZ_CP115456:1118423-1118938 [Sphingobium yanoikuyae]
MTRRRVTPPERLNADHCVDGFENGRHASLDHWLAERALASEGASARTYVVCDADRPGHVAGYYTITTAMEERAALPTARL
RRGMPDKVPLLLIARLAVDVGFQGLGLGADLLADALRRCAAASEIAGVRAVIVHAIDDAAVGFYERHGFIASPLGERVLL
MPIEAVRALQG
MTRRRVTPPERLNADHCVDGFENGRHASLDHWLAERALASEGASARTYVVCDADRPGHVAGYYTITTAMEERAALPTARL
RRGMPDKVPLLLIARLAVDVGFQGLGLGADLLADALRRCAAASEIAGVRAVIVHAIDDAAVGFYERHGFIASPLGERVLL
MPIEAVRALQG
Download Length: 516 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|